KEGG   Parvularcula bermudensis: PB2503_10894Help
Entry
PB2503_10894      CDS       T01298                                 

Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
pbr  Parvularcula bermudensis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PB2503_10894
Enzymes [BR:pbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PB2503_10894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2173862..2174833
Genome map
AA seq 323 aa AA seqDB search
MGDAPLITVPHNPLPEGLSAFFVSSYDGATLRLATLNGPSGPSAPGRRGAILVHPGWAEY
IEKYGEVAEELHHRGFDVLLLDPRGQGLSQRVSPGDDRALIDNFDKFTEDFSVAVAEMTA
RYAPPYHVLAHSMGGLITLLSLLKPSPIAVEKVILSAPLTRLFSGDLTRGVTRGLVSTIC
RLGFGRRPLAGRSDQAMNFEINRLTHDPIRHERFRQLLLARPDTAAGPPRFAWVRSAFRA
MDTLTPAALNRALRHPILVASADADVTVDPRHHRELAVTVPNWHLVRIPHSRHEILMEKD
VFRTQFWRAFDDYLPPVPPIDKA
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacgccccgctgatcacggttcctcacaatccgctgcctgagggattgtcggct
tttttcgtgtcttcctatgatggggccaccctccgtctcgccacgctgaacgggccttcc
ggtccgtcggcgccgggacggcggggggcgatcctggttcatccggggtgggcggaatat
atcgaaaaatatggggaggtcgcggaggaattgcaccaccgcgggttcgatgtgctgctt
cttgatcccaggggacaaggcctgtcccaacgagtgagcccaggggacgaccgggctctc
atcgataatttcgataaatttactgaggatttttccgtcgcggtcgcggagatgacggcg
cgatatgccccgccctaccacgtccttgcccattccatggggggattgatcacccttctg
agtttattgaagccatcaccaattgccgtggagaaggtcatactcagtgcgcccctgacg
cgtctgttttccggcgatcttacgcgcggtgtgacgcgtggacttgtctcaacaatctgt
cggctcggctttggacgccggccccttgcggggcggtctgatcaagccatgaatttcgag
atcaatcggttgacccatgacccgatccgccacgagcgattccgccaactcctcctggcg
cgccccgatacagccgcaggtcccccccgctttgcgtgggtgagaagcgcgttccgtgcg
atggataccctgacaccggcggcgcttaatcgggccctccgccatcccatcctcgtggcc
tcggccgatgccgatgtgaccgtcgatccgcgccatcatcgcgaattggccgtgacggtt
cccaattggcatctcgtccgtattccgcattcccgtcacgaaatcctgatggagaaggac
gtctttcgaacacagttctggcgcgcctttgacgattatcttccgccggtcccgccgatc
gataaggcatag

DBGET integrated database retrieval system