KEGG   Parvularcula bermudensis: PB2503_10939Help
Entry
PB2503_10939      CDS       T01298                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pbr  Parvularcula bermudensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PB2503_10939
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PB2503_10939
   00630 Glyoxylate and dicarboxylate metabolism
    PB2503_10939
Enzymes [BR:pbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PB2503_10939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2184370..2186511
Genome map
AA seq 713 aa AA seqDB search
MADNRVERSGLSIEAGLADFIENEVLAPMGRDQAAFWEGAAKIIADFTPKNRALLAKRAE
LQAKIDDYHRETKAPVDQASYQAFLRDIGYLVDDPAPFSVDTENVDPELATLAGPQLVVP
VLNARYALNAANARWGSLYDAFYGTDAIPFTGSEQKGYDPERGSRVIAQAKAFLDKAAPL
NDGIHSEVKRYCIEEGKLIPTLRDPGQFVGYTGEPEAPQTLLLRHHGLHIEIRIDADHPI
GKTDPAHVADIHLESALSSIVDLEDSVAAVDGEDKTLAYRNWLGLMRGDLKETFEKGGET
RTRELQADRAYTAASGEGEVTVKGRSLLLVRNVGHLMTNPAVQLADGTDVPEGILDAIVT
SLCSIVDVEGKGRFRNSEKGSVYIVKPKMHGPEECAFTNELFDAVEDLHQLPRHTLKVGV
MDEERRTSANLAACIEAVRHRIVFINTGFLDRTGDEMHTSMEAGPMIRKAEMKGSSWIDA
YEKRNVAIGLACGLSGKAQIGKGMWAAPDRMADMLEQKIGHPKTGANCAWVPSPTAATLH
ALHYHEVDVFARQDEVKAAGIPSLDDLLTIPVARETNWPEEALRNEIENNVQGILGYVVR
WIDQGVGCSKVPDINDIGLMEDRATLRISSQHVANWLHHGIVSADMVTAAFEKMAEKVDA
QNAGDPAYEPMAPNFDASIAYQAAKALVFEGRVQPSGYTEPLLHQYRLKKKSQ
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaccgggtcgaacggtcgggcctgtcgattgaagcgggtctcgccgatttt
atcgaaaacgaagtgttggcgccgatgggtcgcgatcaggcggccttttgggagggcgcg
gcgaagatcatcgctgatttcacgccgaaaaatcgggcattgctggcaaagcgcgccgaa
ctccaggctaaaatcgacgactatcaccgggagaccaaggccccggtcgaccaagcgagc
tatcaggcgtttctccgcgacattggctatctggtcgacgaccccgccccgttttccgtt
gatactgagaatgttgatcctgaacttgccaccctggccggcccgcagcttgtcgttccc
gtcctgaacgcccggtatgcgctcaacgccgccaatgcgcggtggggcagcctctatgac
gcgttttacggcaccgatgcgatcccgttcacggggtcggagcaaaagggatatgatccc
gagcgggggagccgggtcatcgcccaggcgaaggcgtttctcgacaaagccgccccgctt
aatgacggtattcacagcgaagtgaaacgctactgcattgaggaggggaaacttatcccc
accctgagggatcccggccagtttgtcggctataccggcgagcccgaggcgccccagacc
cttctcctccgccaccatggtttgcatattgagatccggatcgatgcggatcatccgatc
ggcaaaaccgacccggcgcatgtcgcggatatccatcttgaatcggcgctctcttcgatc
gtcgacctcgaagactccgtcgcggccgtcgatggtgaggataagacccttgcctatcgg
aactggctgggattgatgcgcggcgatctcaaggagaccttcgagaaggggggagaaacc
cgcacacgcgaactgcaggcggaccgcgcctacaccgccgcttcgggggagggagaggtg
accgtcaagggtcgttcactcctccttgtacggaatgttggacacttgatgaccaatccc
gccgtgcagctggctgacgggaccgatgtccctgagggcattctcgacgctatcgtgacg
agcctgtgctcgatcgtcgatgtcgaaggaaagggccgtttccgcaattccgaaaagggc
tcggtctatatcgtcaaaccgaagatgcacgggcccgaggaatgtgcgttcacgaacgag
ctgtttgatgccgtcgaggatcttcaccaattgccccgacacacgttgaaggtcggtgtg
atggacgaggaacgtcggacatccgcgaacctcgccgcctgtatcgaagctgttcgtcat
cggatcgtctttatcaataccgggttcctcgatcggaccggggacgaaatgcacacctcc
atggaggccggtccgatgattcgtaaggcggagatgaaaggctcgtcctggattgatgcg
tatgagaagcgcaatgtcgcgatcggccttgcctgtggcctgtcgggcaaagcccagatc
ggcaaaggcatgtgggcggcgccggatcgcatggcagacatgctcgagcaaaagatcggc
cacccgaagaccggcgccaattgcgcctgggttccaagtcccacggcggcgacgctccac
gcgctccactatcacgaggtggatgtctttgcccgtcaggacgaggtgaaggccgccggg
atcccctcccttgacgatcttctgacaattcccgtggcgcgggagacgaattggcctgag
gaggcgctgcgcaacgagatcgaaaacaacgtccaggggatccttggctatgttgtgcgc
tggatcgaccaaggggttggctgttcgaaggtccccgacatcaacgatatcggcctgatg
gaagatcgagccactttgcgtatttcctcacagcatgtggcaaactggcttcaccacggc
atcgtctcggcggatatggtcaccgcagcgttcgagaagatggcggaaaaggtcgacgcg
cagaatgccggcgacccggcctatgaaccgatggccccgaatttcgatgcgtcgattgcg
tatcaagcggccaaggccctggtctttgaggggcgggtccagccgagcggctataccgaa
ccgctgcttcaccaatatcggctgaagaagaaatctcagtaa

DBGET integrated database retrieval system