KEGG   Parvularcula bermudensis: PB2503_10939Help
Entry
PB2503_10939      CDS       T01298                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
pbr  Parvularcula bermudensis
Pathway
pbr00620  Pyruvate metabolism
pbr00630  Glyoxylate and dicarboxylate metabolism
pbr01100  Metabolic pathways
pbr01110  Biosynthesis of secondary metabolites
pbr01120  Microbial metabolism in diverse environments
pbr01200  Carbon metabolism
Module
pbr_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PB2503_10939
   00630 Glyoxylate and dicarboxylate metabolism
    PB2503_10939
Enzymes [BR:pbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PB2503_10939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ADM10235
UniProt: E0THU2
Position
2184370..2186511
Genome map
AA seq 713 aa AA seqDB search
MADNRVERSGLSIEAGLADFIENEVLAPMGRDQAAFWEGAAKIIADFTPKNRALLAKRAE
LQAKIDDYHRETKAPVDQASYQAFLRDIGYLVDDPAPFSVDTENVDPELATLAGPQLVVP
VLNARYALNAANARWGSLYDAFYGTDAIPFTGSEQKGYDPERGSRVIAQAKAFLDKAAPL
NDGIHSEVKRYCIEEGKLIPTLRDPGQFVGYTGEPEAPQTLLLRHHGLHIEIRIDADHPI
GKTDPAHVADIHLESALSSIVDLEDSVAAVDGEDKTLAYRNWLGLMRGDLKETFEKGGET
RTRELQADRAYTAASGEGEVTVKGRSLLLVRNVGHLMTNPAVQLADGTDVPEGILDAIVT
SLCSIVDVEGKGRFRNSEKGSVYIVKPKMHGPEECAFTNELFDAVEDLHQLPRHTLKVGV
MDEERRTSANLAACIEAVRHRIVFINTGFLDRTGDEMHTSMEAGPMIRKAEMKGSSWIDA
YEKRNVAIGLACGLSGKAQIGKGMWAAPDRMADMLEQKIGHPKTGANCAWVPSPTAATLH
ALHYHEVDVFARQDEVKAAGIPSLDDLLTIPVARETNWPEEALRNEIENNVQGILGYVVR
WIDQGVGCSKVPDINDIGLMEDRATLRISSQHVANWLHHGIVSADMVTAAFEKMAEKVDA
QNAGDPAYEPMAPNFDASIAYQAAKALVFEGRVQPSGYTEPLLHQYRLKKKSQ
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaccgggtcgaacggtcgggcctgtcgattgaagcgggtctcgccgatttt
atcgaaaacgaagtgttggcgccgatgggtcgcgatcaggcggccttttgggagggcgcg
gcgaagatcatcgctgatttcacgccgaaaaatcgggcattgctggcaaagcgcgccgaa
ctccaggctaaaatcgacgactatcaccgggagaccaaggccccggtcgaccaagcgagc
tatcaggcgtttctccgcgacattggctatctggtcgacgaccccgccccgttttccgtt
gatactgagaatgttgatcctgaacttgccaccctggccggcccgcagcttgtcgttccc
gtcctgaacgcccggtatgcgctcaacgccgccaatgcgcggtggggcagcctctatgac
gcgttttacggcaccgatgcgatcccgttcacggggtcggagcaaaagggatatgatccc
gagcgggggagccgggtcatcgcccaggcgaaggcgtttctcgacaaagccgccccgctt
aatgacggtattcacagcgaagtgaaacgctactgcattgaggaggggaaacttatcccc
accctgagggatcccggccagtttgtcggctataccggcgagcccgaggcgccccagacc
cttctcctccgccaccatggtttgcatattgagatccggatcgatgcggatcatccgatc
ggcaaaaccgacccggcgcatgtcgcggatatccatcttgaatcggcgctctcttcgatc
gtcgacctcgaagactccgtcgcggccgtcgatggtgaggataagacccttgcctatcgg
aactggctgggattgatgcgcggcgatctcaaggagaccttcgagaaggggggagaaacc
cgcacacgcgaactgcaggcggaccgcgcctacaccgccgcttcgggggagggagaggtg
accgtcaagggtcgttcactcctccttgtacggaatgttggacacttgatgaccaatccc
gccgtgcagctggctgacgggaccgatgtccctgagggcattctcgacgctatcgtgacg
agcctgtgctcgatcgtcgatgtcgaaggaaagggccgtttccgcaattccgaaaagggc
tcggtctatatcgtcaaaccgaagatgcacgggcccgaggaatgtgcgttcacgaacgag
ctgtttgatgccgtcgaggatcttcaccaattgccccgacacacgttgaaggtcggtgtg
atggacgaggaacgtcggacatccgcgaacctcgccgcctgtatcgaagctgttcgtcat
cggatcgtctttatcaataccgggttcctcgatcggaccggggacgaaatgcacacctcc
atggaggccggtccgatgattcgtaaggcggagatgaaaggctcgtcctggattgatgcg
tatgagaagcgcaatgtcgcgatcggccttgcctgtggcctgtcgggcaaagcccagatc
ggcaaaggcatgtgggcggcgccggatcgcatggcagacatgctcgagcaaaagatcggc
cacccgaagaccggcgccaattgcgcctgggttccaagtcccacggcggcgacgctccac
gcgctccactatcacgaggtggatgtctttgcccgtcaggacgaggtgaaggccgccggg
atcccctcccttgacgatcttctgacaattcccgtggcgcgggagacgaattggcctgag
gaggcgctgcgcaacgagatcgaaaacaacgtccaggggatccttggctatgttgtgcgc
tggatcgaccaaggggttggctgttcgaaggtccccgacatcaacgatatcggcctgatg
gaagatcgagccactttgcgtatttcctcacagcatgtggcaaactggcttcaccacggc
atcgtctcggcggatatggtcaccgcagcgttcgagaagatggcggaaaaggtcgacgcg
cagaatgccggcgacccggcctatgaaccgatggccccgaatttcgatgcgtcgattgcg
tatcaagcggccaaggccctggtctttgaggggcgggtccagccgagcggctataccgaa
ccgctgcttcaccaatatcggctgaagaagaaatctcagtaa

DBGET integrated database retrieval system