KEGG   Parvularcula bermudensis: PB2503_10939Help
Entry
PB2503_10939      CDS       T01298                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
pbr  Parvularcula bermudensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PB2503_10939
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PB2503_10939
   00630 Glyoxylate and dicarboxylate metabolism
    PB2503_10939
Enzymes [BR:pbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PB2503_10939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2184370..2186511
Genome map
AA seq 713 aa AA seqDB search
MADNRVERSGLSIEAGLADFIENEVLAPMGRDQAAFWEGAAKIIADFTPKNRALLAKRAE
LQAKIDDYHRETKAPVDQASYQAFLRDIGYLVDDPAPFSVDTENVDPELATLAGPQLVVP
VLNARYALNAANARWGSLYDAFYGTDAIPFTGSEQKGYDPERGSRVIAQAKAFLDKAAPL
NDGIHSEVKRYCIEEGKLIPTLRDPGQFVGYTGEPEAPQTLLLRHHGLHIEIRIDADHPI
GKTDPAHVADIHLESALSSIVDLEDSVAAVDGEDKTLAYRNWLGLMRGDLKETFEKGGET
RTRELQADRAYTAASGEGEVTVKGRSLLLVRNVGHLMTNPAVQLADGTDVPEGILDAIVT
SLCSIVDVEGKGRFRNSEKGSVYIVKPKMHGPEECAFTNELFDAVEDLHQLPRHTLKVGV
MDEERRTSANLAACIEAVRHRIVFINTGFLDRTGDEMHTSMEAGPMIRKAEMKGSSWIDA
YEKRNVAIGLACGLSGKAQIGKGMWAAPDRMADMLEQKIGHPKTGANCAWVPSPTAATLH
ALHYHEVDVFARQDEVKAAGIPSLDDLLTIPVARETNWPEEALRNEIENNVQGILGYVVR
WIDQGVGCSKVPDINDIGLMEDRATLRISSQHVANWLHHGIVSADMVTAAFEKMAEKVDA
QNAGDPAYEPMAPNFDASIAYQAAKALVFEGRVQPSGYTEPLLHQYRLKKKSQ
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggctgataaccgggtcgaacggtcgggcctgtcgattgaagcgggtctcgccgatttt
atcgaaaacgaagtgttggcgccgatgggtcgcgatcaggcggccttttgggagggcgcg
gcgaagatcatcgctgatttcacgccgaaaaatcgggcattgctggcaaagcgcgccgaa
ctccaggctaaaatcgacgactatcaccgggagaccaaggccccggtcgaccaagcgagc
tatcaggcgtttctccgcgacattggctatctggtcgacgaccccgccccgttttccgtt
gatactgagaatgttgatcctgaacttgccaccctggccggcccgcagcttgtcgttccc
gtcctgaacgcccggtatgcgctcaacgccgccaatgcgcggtggggcagcctctatgac
gcgttttacggcaccgatgcgatcccgttcacggggtcggagcaaaagggatatgatccc
gagcgggggagccgggtcatcgcccaggcgaaggcgtttctcgacaaagccgccccgctt
aatgacggtattcacagcgaagtgaaacgctactgcattgaggaggggaaacttatcccc
accctgagggatcccggccagtttgtcggctataccggcgagcccgaggcgccccagacc
cttctcctccgccaccatggtttgcatattgagatccggatcgatgcggatcatccgatc
ggcaaaaccgacccggcgcatgtcgcggatatccatcttgaatcggcgctctcttcgatc
gtcgacctcgaagactccgtcgcggccgtcgatggtgaggataagacccttgcctatcgg
aactggctgggattgatgcgcggcgatctcaaggagaccttcgagaaggggggagaaacc
cgcacacgcgaactgcaggcggaccgcgcctacaccgccgcttcgggggagggagaggtg
accgtcaagggtcgttcactcctccttgtacggaatgttggacacttgatgaccaatccc
gccgtgcagctggctgacgggaccgatgtccctgagggcattctcgacgctatcgtgacg
agcctgtgctcgatcgtcgatgtcgaaggaaagggccgtttccgcaattccgaaaagggc
tcggtctatatcgtcaaaccgaagatgcacgggcccgaggaatgtgcgttcacgaacgag
ctgtttgatgccgtcgaggatcttcaccaattgccccgacacacgttgaaggtcggtgtg
atggacgaggaacgtcggacatccgcgaacctcgccgcctgtatcgaagctgttcgtcat
cggatcgtctttatcaataccgggttcctcgatcggaccggggacgaaatgcacacctcc
atggaggccggtccgatgattcgtaaggcggagatgaaaggctcgtcctggattgatgcg
tatgagaagcgcaatgtcgcgatcggccttgcctgtggcctgtcgggcaaagcccagatc
ggcaaaggcatgtgggcggcgccggatcgcatggcagacatgctcgagcaaaagatcggc
cacccgaagaccggcgccaattgcgcctgggttccaagtcccacggcggcgacgctccac
gcgctccactatcacgaggtggatgtctttgcccgtcaggacgaggtgaaggccgccggg
atcccctcccttgacgatcttctgacaattcccgtggcgcgggagacgaattggcctgag
gaggcgctgcgcaacgagatcgaaaacaacgtccaggggatccttggctatgttgtgcgc
tggatcgaccaaggggttggctgttcgaaggtccccgacatcaacgatatcggcctgatg
gaagatcgagccactttgcgtatttcctcacagcatgtggcaaactggcttcaccacggc
atcgtctcggcggatatggtcaccgcagcgttcgagaagatggcggaaaaggtcgacgcg
cagaatgccggcgacccggcctatgaaccgatggccccgaatttcgatgcgtcgattgcg
tatcaagcggccaaggccctggtctttgaggggcgggtccagccgagcggctataccgaa
ccgctgcttcaccaatatcggctgaagaagaaatctcagtaa

DBGET integrated database retrieval system