KEGG   Parvularcula bermudensis: PB2503_11224Help
Entry
PB2503_11224      CDS       T01298                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pbr  Parvularcula bermudensis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PB2503_11224
Enzymes [BR:pbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PB2503_11224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2249118..2249753)
Genome map
AA seq 211 aa AA seqDB search
MRMAPIDRRGLMLIVSSPSGAGKTTLSRRLLADDPAIHLSVSATTRPKRSNEIHGKDYFF
VDEATFVEQRERGDFLESALVFGNYYGTPRTEVVKAVEAGRDVLFDIDWQGAQQLAEVMP
QDLVTVFILPPSRQSLEDRLRSRNQDSEAVVMDRMKKADSEISHYAEYDYVILNDDINRA
SSELKAILMAERLKRQRQTGLSQFVRSIIGT
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatggctccgattgatcgtcgcggattgatgttaatcgtctccagcccctccggg
gccgggaaaacgactctcagccgccgcctgctggcggacgatcctgcgatccatctgtcc
gtgtctgcaaccacccgccccaagcgctccaatgaaattcacggtaaggattatttcttc
gtcgatgaagcgacgttcgttgagcagcgggagcggggcgatttcctcgaatccgccctc
gtcttcggcaattattacggtacgccgcggactgaggttgtgaaggcggtggaggccgga
cgtgacgtcctctttgatatcgattggcaaggagcccagcagctcgccgaggtgatgccg
caggatcttgtcaccgtgtttattctgccgccatcgcgccaatcattggaggaccgtctc
cgtagccgcaaccaggattcagaagccgtggtcatggaccgcatgaaaaaagcggattcg
gaaatttctcattatgctgaatatgattatgtcattcttaatgacgatatcaatcgtgcc
tcgtcggagttgaaagcgatcctcatggccgaacggttgaaacgtcagcgccagacaggg
ctcagccaatttgtccgaagtattatcgggacgtaa

DBGET integrated database retrieval system