KEGG   Parvularcula bermudensis: PB2503_13224Help
Entry
PB2503_13224      CDS       T01298                                 

Definition
Triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pbr  Parvularcula bermudensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:pbr01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pbr01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pbr00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pbr00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:pbr00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2710767..2711504)
Genome map
AA seq 245 aa AA seqDB search
MIQNMGDGDVRRLIAGNWKMNGLEDDLAEVTTLAQRLETPRPDNVDVVICPPATLIAPMH
ALQFDTIGLGAQDCHTEESGAYTGDLSAAMLRDAGACYCIVGHSERRDYHGETDEVVKAK
LAAALKADLIPILCVGENLETREAGKAVDTVVAQLKAAFPGAGKGVVVAYEPIWAIGTGK
TAGPAEIEEMHAALRQATSPDTRLLYGGSVKPGNAAEILAVSNVNGALVGGASLKADDFE
PIVRA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgatccaaaatatgggagatggtgacgtgcgcagactgatcgctggaaattggaagatg
aacggtctcgaagacgatctcgctgaggtcacgaccttggcccaacgcctcgagacccca
aggccggacaatgtcgatgtggtgatctgcccccccgcgaccctgatcgccccgatgcat
gccctccaattcgacacgatcgggctcggcgcgcaggactgccataccgaggaaagcggc
gcctataccggcgatttgtcggcggccatgttgcgcgatgccggggcctgttattgtatc
gtcggccactcggagcggcgggactatcacggtgagacagatgaggtggtcaaggcaaaa
ctggcggccgccctcaaggccgatttgatccccattctctgtgttggggagaatcttgaa
acccgggaagctggcaaggccgtcgacaccgttgtcgcccagctcaaggcggcgtttccg
ggggcgggcaagggcgttgtcgtggcctatgagccgatctgggcgatcgggacggggaaa
accgccggcccggcggagatcgaagagatgcatgcagccctgcgtcaggcgaccagcccg
gacacgcggttgctctatggggggtcggtcaagcccggtaacgccgcggagattctggcg
gtgtccaatgtcaacggcgcgctggtgggcggggccagcctcaaggctgatgatttcgag
cctattgtgagggcctga

DBGET integrated database retrieval system