KEGG   Parvularcula bermudensis: PB2503_13224Help
Entry
PB2503_13224      CDS       T01298                                 

Definition
(RefSeq) Triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pbr  Parvularcula bermudensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PB2503_13224
   01230 Biosynthesis of amino acids
    PB2503_13224
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PB2503_13224
   00051 Fructose and mannose metabolism
    PB2503_13224
   00562 Inositol phosphate metabolism
    PB2503_13224
Enzymes [BR:pbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PB2503_13224
Exosome [BR:pbr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PB2503_13224
  Exosomal proteins of bladder cancer cells
   PB2503_13224
  Exosomal proteins of melanoma cells
   PB2503_13224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2710767..2711504)
Genome map
AA seq 245 aa AA seqDB search
MIQNMGDGDVRRLIAGNWKMNGLEDDLAEVTTLAQRLETPRPDNVDVVICPPATLIAPMH
ALQFDTIGLGAQDCHTEESGAYTGDLSAAMLRDAGACYCIVGHSERRDYHGETDEVVKAK
LAAALKADLIPILCVGENLETREAGKAVDTVVAQLKAAFPGAGKGVVVAYEPIWAIGTGK
TAGPAEIEEMHAALRQATSPDTRLLYGGSVKPGNAAEILAVSNVNGALVGGASLKADDFE
PIVRA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgatccaaaatatgggagatggtgacgtgcgcagactgatcgctggaaattggaagatg
aacggtctcgaagacgatctcgctgaggtcacgaccttggcccaacgcctcgagacccca
aggccggacaatgtcgatgtggtgatctgcccccccgcgaccctgatcgccccgatgcat
gccctccaattcgacacgatcgggctcggcgcgcaggactgccataccgaggaaagcggc
gcctataccggcgatttgtcggcggccatgttgcgcgatgccggggcctgttattgtatc
gtcggccactcggagcggcgggactatcacggtgagacagatgaggtggtcaaggcaaaa
ctggcggccgccctcaaggccgatttgatccccattctctgtgttggggagaatcttgaa
acccgggaagctggcaaggccgtcgacaccgttgtcgcccagctcaaggcggcgtttccg
ggggcgggcaagggcgttgtcgtggcctatgagccgatctgggcgatcgggacggggaaa
accgccggcccggcggagatcgaagagatgcatgcagccctgcgtcaggcgaccagcccg
gacacgcggttgctctatggggggtcggtcaagcccggtaacgccgcggagattctggcg
gtgtccaatgtcaacggcgcgctggtgggcggggccagcctcaaggctgatgatttcgag
cctattgtgagggcctga

DBGET integrated database retrieval system