KEGG   Parvularcula bermudensis: PB2503_13224Help
Entry
PB2503_13224      CDS       T01298                                 

Definition
Triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pbr  Parvularcula bermudensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PB2503_13224
   01230 Biosynthesis of amino acids
    PB2503_13224
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PB2503_13224
   00051 Fructose and mannose metabolism
    PB2503_13224
   00562 Inositol phosphate metabolism
    PB2503_13224
Enzymes [BR:pbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PB2503_13224
Exosome [BR:pbr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PB2503_13224
  Exosomal proteins of bladder cancer cells
   PB2503_13224
  Exosomal proteins of melanoma cells
   PB2503_13224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2710767..2711504)
Genome map
AA seq 245 aa AA seqDB search
MIQNMGDGDVRRLIAGNWKMNGLEDDLAEVTTLAQRLETPRPDNVDVVICPPATLIAPMH
ALQFDTIGLGAQDCHTEESGAYTGDLSAAMLRDAGACYCIVGHSERRDYHGETDEVVKAK
LAAALKADLIPILCVGENLETREAGKAVDTVVAQLKAAFPGAGKGVVVAYEPIWAIGTGK
TAGPAEIEEMHAALRQATSPDTRLLYGGSVKPGNAAEILAVSNVNGALVGGASLKADDFE
PIVRA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgatccaaaatatgggagatggtgacgtgcgcagactgatcgctggaaattggaagatg
aacggtctcgaagacgatctcgctgaggtcacgaccttggcccaacgcctcgagacccca
aggccggacaatgtcgatgtggtgatctgcccccccgcgaccctgatcgccccgatgcat
gccctccaattcgacacgatcgggctcggcgcgcaggactgccataccgaggaaagcggc
gcctataccggcgatttgtcggcggccatgttgcgcgatgccggggcctgttattgtatc
gtcggccactcggagcggcgggactatcacggtgagacagatgaggtggtcaaggcaaaa
ctggcggccgccctcaaggccgatttgatccccattctctgtgttggggagaatcttgaa
acccgggaagctggcaaggccgtcgacaccgttgtcgcccagctcaaggcggcgtttccg
ggggcgggcaagggcgttgtcgtggcctatgagccgatctgggcgatcgggacggggaaa
accgccggcccggcggagatcgaagagatgcatgcagccctgcgtcaggcgaccagcccg
gacacgcggttgctctatggggggtcggtcaagcccggtaacgccgcggagattctggcg
gtgtccaatgtcaacggcgcgctggtgggcggggccagcctcaaggctgatgatttcgag
cctattgtgagggcctga

DBGET integrated database retrieval system