KEGG   Parvularcula bermudensis: PB2503_13274Help
Entry
PB2503_13274      CDS       T01298                                 

Definition
indole-3-glycerol-phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pbr  Parvularcula bermudensis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pbr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PB2503_13274
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PB2503_13274
Enzymes [BR:pbr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PB2503_13274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2720048..2720830
Genome map
AA seq 260 aa AA seqDB search
MTILDDIIAYKKDEVRAAKAERAPAAVDRDAQDRRDVRPFAHALDETAKAGFGLIAEIKK
ASPSKGLIRADFDPARLAEAYQSGGAACLSVLTDQPAFQGHPTFLEAARGATDLPALRKD
FMIDPYQVGEARLWGADAILLIMAVLSDSQAAELAAAATSYGMDILIEVHDEAELDRALS
LPRGLLGVNNRNLHTFETDLGVSERLAPLAGDRALVAESGIAGHADLLRLERSGIRRALV
GESLMRQADVTAATRTLLGL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgacgatcctcgacgatattatcgcctataagaaggatgaggttcgcgccgccaaggcc
gagcgcgcgcccgccgcggtggaccgcgatgcccaggatcggcgggatgttcggcccttc
gcccacgccctcgatgagacagccaaggccggttttggcctgatcgccgaaatcaaaaag
gccagtccctccaagggactgatccgcgccgatttcgatcccgctcgattggcggaggcc
tatcaaagcggcggggcggcctgtctctccgtcctcaccgaccagccggcctttcaagga
catccgacctttctggaggcggcgcggggcgccaccgatctccccgccctcagaaaagac
ttcatgatcgacccctatcaagtcggcgaggcgcgcctttggggggctgatgccatcttg
ctgatcatggccgtgctgtcggactcgcaagcggcggaattggcggcggcggcgacaagc
tacggcatggatatcctcatcgaggtgcatgacgaggcggaactcgaccgggccctgtcc
ctgccgcggggccttctgggggtgaataaccgcaacctccatacgtttgagaccgatctc
ggcgtcagtgagcgattggcgcccctggcgggggaccgcgccttggtggccgaaagcggg
atcgccggccacgccgatctcctgcgcctcgaacgcagcggcataaggcgcgccctggtt
ggggaaagcctgatgcgacaggctgatgtgacggccgcgacgcgcaccctgctggggctt
tag

DBGET integrated database retrieval system