KEGG   Planctomyces brasiliensis: Plabr_0017Help
Entry
Plabr_0017        CDS       T01431                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pbs  Planctomyces brasiliensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pbs00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Plabr_0017
Enzymes [BR:pbs01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Plabr_0017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
23223..23849
Genome map
AA seq 208 aa AA seqDB search
MISSIRGELLALEETSAFLNIGAFTIEVFIPDFVRRQLQGKIGEPIELRTMAYLDGNPQK
GGRMTPRLVGFTSKAELAFFELICSVDGLGIKKALAAIVRPVREVAAAIEQQDTKTLSTL
PGIGPAVAERIVAKLRRKMTRFALMVDQASGEAYEPMNDQVSETYEALLALGHSADDAHN
KIDTALKSGKKFKSVEDMLTAIYQQEYS
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
ttgatttcttccattcgtggagagctgcttgctctcgaagagacttccgcctttctcaat
attggagcattcaccattgaggtcttcataccggactttgtccgtagacagctccagggg
aaaatcggggagccgattgagctacggacaatggcgtacctcgatggcaatccgcagaaa
gggggccggatgactccccggctggtcggcttcaccagcaaggccgaactcgccttcttc
gagttgatctgttcggtcgacggactgggtatcaaaaaagcgttggccgcgatcgtgcgt
cccgttcgcgaagtggccgccgccatcgaacagcaggacacaaaaacactcagcacgttg
cccggaatcggcccggctgtcgcggaacggattgtcgccaagctgcgtcgtaagatgacc
cggttcgcgctgatggtcgatcaggcgagcggcgaagcctacgagccgatgaacgatcag
gtcagcgaaacctacgaagcgttgctcgcgctgggccattcggccgacgacgcacacaac
aagatcgacacggctctcaagtcgggcaagaaattcaaatcggtcgaggacatgctcacc
gccatctatcagcaggaatacagctga

DBGET integrated database retrieval system