KEGG   Planctomyces brasiliensis: Plabr_0430Help
Entry
Plabr_0430        CDS       T01431                                 

Definition
2-oxoglutarate dehydrogenase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pbs  Planctomyces brasiliensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pbs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Plabr_0430
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Plabr_0430
  Amino acid metabolism
   00310 Lysine degradation
    Plabr_0430
Enzymes [BR:pbs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Plabr_0430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(509466..510671)
Genome map
AA seq 401 aa AA seqDB search
MATEIVVPAVGESISEVQIGEWYVDAGKWVSADTDLVGLETDKATFDVPAPAGGRVTRIV
KQAGETAAVGDVIAYFEEEEQPAGAENGTPESSAPAAKASGQPGQTSKPAAPTGGQAATS
DKVMPAAARELAQRKMSADQVSPSGPGGRLLKEDVLAAEGTAAAPAAAQRSEEVVPLSPI
RRRIAERLVDAQHNAALLTTFNEIDMSNVMSLRNQYKDSFIKKYDVKLGFMSFFVKAVVD
ALNQYPQVGAQMRDNQLVYRNYYDIGVAVGGGKGLVVPILRNAERMSFAEIELKISDFGR
RARDNKISLDEMEGGSFTITNGGVYGSLLSTPIVNPPQSGVLGMHGIFERPVARNGEVVI
RPMMYVALTYDHRVVDGREAVSFLKRICEAVEDPSRMLMEI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggagattgtagttcctgcggttggcgagtcgatttccgaagttcaaattggc
gagtggtatgtcgatgcggggaaatgggtctccgccgacaccgatctcgtgggtttggaa
accgacaaagccacatttgatgttcccgcccccgcaggcggacgcgtgactcgcattgtt
aagcaggctggcgaaaccgccgctgttggcgatgtgattgcctacttcgaagaagaggag
cagccggccggtgcagaaaacggcacgccggaatcttccgctcccgccgcgaaggcaagc
ggtcagcctggtcagaccagcaagccagccgcccccaccggaggacaggctgcgacttcc
gataaagtgatgccggccgccgctcgcgagttggcccagaggaaaatgtccgccgatcag
gtcagccccagtggtcctggagggcgcctgctgaaagaagacgtgcttgcagcggaaggg
actgcggccgctcccgcagctgcacagcggtcggaagaagtggttccgctcagcccgatc
cgtcgtcgtattgccgaacgtctggtcgatgcacagcacaatgccgctctgctgaccacc
tttaatgaaatcgacatgtcgaatgtcatgtcgctccggaatcaatacaaagattcgttc
atcaagaagtacgatgtgaagctgggcttcatgtccttctttgtgaaagcggtcgtcgat
gccctcaatcagtatccgcaggtgggggctcagatgcgtgataaccagctggtgtaccgc
aactactacgatatcggagtggctgttggtggcgggaaggggttggtggttcccatcttg
cgaaacgccgaacggatgagcttcgccgaaatcgaactgaagatttccgatttcggacgg
cgggctcgcgacaacaaaatttcgctggacgaaatggaaggcggctcgttcaccatcacc
aacggtggcgtgtacgggtcgttgctttccacaccgattgtgaatcctccgcagagtggt
gtgcttggcatgcacggcattttcgaacggccggtcgcccgcaacggcgaagttgtcatt
cggccaatgatgtatgtcgcgctcacttacgaccaccgcgttgtcgacggtcgtgaagcg
gtttccttcctcaagcgtatctgcgaggccgtggaagatccgtcccggatgctgatggaa
atctga

DBGET integrated database retrieval system