KEGG   Planctomyces brasiliensis: Plabr_0467Help
Entry
Plabr_0467        CDS       T01431                                 

Definition
pyrophosphate-dependent phosphofructokinase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pbs  Planctomyces brasiliensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pbs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Plabr_0467
   01230 Biosynthesis of amino acids
    Plabr_0467
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Plabr_0467
   00030 Pentose phosphate pathway
    Plabr_0467
   00051 Fructose and mannose metabolism
    Plabr_0467
   00052 Galactose metabolism
    Plabr_0467
  Energy metabolism
   00680 Methane metabolism
    Plabr_0467
Enzymes [BR:pbs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Plabr_0467
Protein phosphatases and associated proteins [BR:pbs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Plabr_0467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
556564..557595
Genome map
AA seq 343 aa AA seqDB search
MKVGILTGGGDCPGLNAVIRGVVQVISNAGGQCLGLQEGWRGAITGEHEILTPEMTRPII
DQGGTILGSSRTNPFKNPEEIEQIEKTFKNLGMDALVAIGGDDTLGVASKLYHEKGLPTI
GCPKTIDNDLSATDQTFGFDTCINIVMDAVDRLRTTAMSHRRVLVVEVMGRHAGWIACYS
AMATGADYFMVPEREVNIDEMINVLQKRLDAGQKYGIVVVSEGAKLSNDGDFVTKDAEID
EFGHVKLGGIGDRVAKIIEERMGKETRSVTLGHLQRGGSPSAFDRVLGTRLGVHAGHLAL
NKDFGKMVALRGTKIVAVELKDAVDKMRELEDSFFDEAAEFLK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcggtatcttgacgggcggcggtgactgccccggtttgaacgcggttatccgt
ggcgtggtgcaggtcatttccaacgctggcggtcagtgcctcggcctgcaggaaggatgg
cgcggagccatcaccggcgaacacgaaatcctgactcccgagatgactcgcccgatcatc
gatcagggcggcacgatcctcggctcttcccgaaccaacccgttcaaaaacccggaagag
attgagcagattgagaaaaccttcaaaaacctgggaatggatgctctcgtcgccatcggt
ggcgatgacaccctgggtgtggccagcaagctgtaccacgaaaaaggcctgccgactatc
ggctgcccgaaaaccatcgacaacgacctgagcgctaccgatcagacgttcggtttcgat
acctgtatcaacattgtcatggacgctgttgaccgcctgcgtaccaccgcgatgtctcac
cgccgtgtcctggtcgtcgaagtgatgggccgtcacgctggctggatcgcctgttattcc
gccatggccaccggtgctgactacttcatggtgccggaacgcgaagtcaacatcgacgaa
atgatcaacgtgctgcagaaacgtctcgacgccggccagaaatacggcatcgtcgtggtc
agcgaaggcgccaaactgagcaacgacggcgacttcgtcaccaaagacgcagaaatcgac
gagttcggccacgtcaaactgggcggcatcggcgatcgcgttgccaaaatcatcgaagaa
cggatgggcaaagaaacccgttcggtcacactgggtcacctgcagcgtggtggcagcccg
tctgccttcgaccgcgtgctcggaacccgcctgggtgtgcacgccggccacctcgctttg
aataaagacttcggcaaaatggttgctctccgcggcaccaaaatcgtcgccgtcgaactg
aaagacgctgtcgacaaaatgcgtgaactcgaagattccttcttcgacgaagccgccgaa
ttcctgaagtaa

DBGET integrated database retrieval system