KEGG   Rubinisphaera brasiliensis: Plabr_0467Help
Entry
Plabr_0467        CDS       T01431                                 

Definition
(GenBank) pyrophosphate-dependent phosphofructokinase
  KO
K21071  
ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
pbs  Rubinisphaera brasiliensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pbs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Plabr_0467
   00030 Pentose phosphate pathway
    Plabr_0467
   00051 Fructose and mannose metabolism
    Plabr_0467
   00052 Galactose metabolism
    Plabr_0467
  Energy metabolism
   00680 Methane metabolism
    Plabr_0467
Enzymes [BR:pbs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Plabr_0467
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Plabr_0467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
556564..557595
Genome map
AA seq 343 aa AA seqDB search
MKVGILTGGGDCPGLNAVIRGVVQVISNAGGQCLGLQEGWRGAITGEHEILTPEMTRPII
DQGGTILGSSRTNPFKNPEEIEQIEKTFKNLGMDALVAIGGDDTLGVASKLYHEKGLPTI
GCPKTIDNDLSATDQTFGFDTCINIVMDAVDRLRTTAMSHRRVLVVEVMGRHAGWIACYS
AMATGADYFMVPEREVNIDEMINVLQKRLDAGQKYGIVVVSEGAKLSNDGDFVTKDAEID
EFGHVKLGGIGDRVAKIIEERMGKETRSVTLGHLQRGGSPSAFDRVLGTRLGVHAGHLAL
NKDFGKMVALRGTKIVAVELKDAVDKMRELEDSFFDEAAEFLK
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcggtatcttgacgggcggcggtgactgccccggtttgaacgcggttatccgt
ggcgtggtgcaggtcatttccaacgctggcggtcagtgcctcggcctgcaggaaggatgg
cgcggagccatcaccggcgaacacgaaatcctgactcccgagatgactcgcccgatcatc
gatcagggcggcacgatcctcggctcttcccgaaccaacccgttcaaaaacccggaagag
attgagcagattgagaaaaccttcaaaaacctgggaatggatgctctcgtcgccatcggt
ggcgatgacaccctgggtgtggccagcaagctgtaccacgaaaaaggcctgccgactatc
ggctgcccgaaaaccatcgacaacgacctgagcgctaccgatcagacgttcggtttcgat
acctgtatcaacattgtcatggacgctgttgaccgcctgcgtaccaccgcgatgtctcac
cgccgtgtcctggtcgtcgaagtgatgggccgtcacgctggctggatcgcctgttattcc
gccatggccaccggtgctgactacttcatggtgccggaacgcgaagtcaacatcgacgaa
atgatcaacgtgctgcagaaacgtctcgacgccggccagaaatacggcatcgtcgtggtc
agcgaaggcgccaaactgagcaacgacggcgacttcgtcaccaaagacgcagaaatcgac
gagttcggccacgtcaaactgggcggcatcggcgatcgcgttgccaaaatcatcgaagaa
cggatgggcaaagaaacccgttcggtcacactgggtcacctgcagcgtggtggcagcccg
tctgccttcgaccgcgtgctcggaacccgcctgggtgtgcacgccggccacctcgctttg
aataaagacttcggcaaaatggttgctctccgcggcaccaaaatcgtcgccgtcgaactg
aaagacgctgtcgacaaaatgcgtgaactcgaagattccttcttcgacgaagccgccgaa
ttcctgaagtaa

DBGET integrated database retrieval system