KEGG   Rubinisphaera brasiliensis: Plabr_0856Help
Entry
Plabr_0856        CDS       T01431                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pbs  Rubinisphaera brasiliensis
Pathway
pbs00010  Glycolysis / Gluconeogenesis
pbs00620  Pyruvate metabolism
pbs00640  Propanoate metabolism
pbs00680  Methane metabolism
pbs01100  Metabolic pathways
pbs01110  Biosynthesis of secondary metabolites
pbs01120  Microbial metabolism in diverse environments
pbs01130  Biosynthesis of antibiotics
pbs01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pbs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Plabr_0856
   00620 Pyruvate metabolism
    Plabr_0856
   00640 Propanoate metabolism
    Plabr_0856
  Energy metabolism
   00680 Methane metabolism
    Plabr_0856
Enzymes [BR:pbs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Plabr_0856
Lipid biosynthesis proteins [BR:pbs01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Plabr_0856
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADY58479
UniProt: F0SHP1
Position
1008158..1010146
Genome map
AA seq 662 aa AA seqDB search
MSQGESSAAPSSEQHTGSIESVMHEERRFPPPAEFTPRVSFKTEAEYQQAWDRAKDDPAG
FWGELANEHLTWNEPFKETMSGEMPETKWFQGGQLNASAQCLDRHLEKHGNKAAIIWEGE
PGDVRVLRYQDLHREVCRFSNVLKRMGVEKGDRITLYMPMVPELAIAMLACARIGATHSI
IFGGFSSDAVAERNNDAQAKLVITADAGWRRGKEVPLKSAVDESLEKSPTVEKVIVYQRT
GADVTMVPDRDYWWHELMENESADCDPTPVDSEHPLFILYTSGSTGKPKGVLHTTAGYML
GAMMTTRWVFDLSETDTYWCTADIGWITGHSYVVYGPLANGATTVMYEGAPNWPDEGRFW
ELVEKYRVSLFYTAPTAIRAFMKWGDQWPEKADLSSLRLLGTVGEPINPEAWMWYHRIIG
QEKCPIVDTWWQTETGGIMITPLPGITTTKPGSCTKPLPGVVPAIVDDQGTELGENEGGL
LVMTQPWPHMLRTLYGDHDRFLETYFSKISGRYFAGDGARKDEDGYYWVMGRVDDVLNVS
GHRLSTMEVESALVGHDDVTEAAVVGFPHDLKGEGICCFVTLKGGEGSEEVRKELIQHVR
KQIGAIATPDQIRFAAALPKTRSGKIMRRLLRDIAAGRESAGDTTTLEDYTVLATLRESD
AS
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagggcgaatccagcgccgcaccgtcttctgaacaacacaccggaagcatcgag
agtgtgatgcacgaagagcggcggtttccgccgccggctgaattcacaccgcgcgtcagc
ttcaagactgaagccgaataccaacaggcctgggaccgcgccaaagacgaccctgctgga
ttctggggcgaactggccaacgaacacctcacctggaacgagcccttcaaggaaaccatg
tctggcgaaatgcccgagaccaaatggtttcagggtggtcagctgaacgcttccgctcag
tgcctcgatcgccatctcgaaaagcatggcaacaaagccgccattatctgggaaggcgaa
ccgggcgacgtccgtgtgctgcgttatcaggacctgcatcgcgaagtctgccggttctcc
aatgtcctcaagcggatgggcgtggagaaaggggaccgcatcacgctttatatgccgatg
gttcccgagcttgccatcgccatgctcgcctgtgcccgcattggcgcgacccactcgatc
atcttcggcggtttcagctccgacgccgttgcggaacgcaacaacgatgcccaggcgaaa
ctggttatcaccgccgatgccggctggcgtcgcgggaaagaagtgccgctgaagtctgcc
gtcgacgaaagcctcgaaaagtcgcccaccgtcgagaaggtcatcgtttatcagcggacc
ggcgccgacgtcaccatggttcccgatcgggattactggtggcatgagctgatggaaaat
gaatcggcggactgcgaccccactcccgtggatagcgaacacccgctcttcatcctgtac
acttcgggcagcaccggcaaaccgaaaggggtgctgcacacgaccgccggttacatgctg
ggtgcgatgatgaccacccgttgggtgttcgacctgagcgaaaccgatacatattggtgt
accgccgacatcggctggatcaccgggcacagctacgttgtctacggccccctcgccaac
ggggcaacgacagtgatgtacgaaggcgctcccaactggccagatgaaggtcgcttctgg
gaactggtcgaaaaataccgcgtcagcctgttctacaccgctccgaccgcgattcgcgcc
ttcatgaaatggggcgatcagtggccggagaaggccgatctttccagcctgcgtctactc
ggaaccgtcggcgagccgatcaacccggaagcctggatgtggtatcaccgcatcatcggt
caggaaaaatgcccgatcgtcgatacctggtggcagaccgaaaccggcggcatcatgatc
acgccgcttcccggcataaccacaaccaaaccgggtagctgcaccaaaccgctgcccggc
gttgtccccgcgattgtcgatgatcagggaaccgaactgggcgaaaacgagggtggcctg
ctcgtcatgacgcagccctggcctcatatgctgcggacgctgtatggcgaccacgaccgc
ttcctggaaacctacttctcgaaaatctccggccgctacttcgctggcgacggcgcccgc
aaagacgaagacggctattactgggtgatgggccgtgtcgatgacgtcctcaacgtttct
gggcaccgtttgagcacgatggaagtcgaatcggctctcgtcggccatgatgatgtgacc
gaagcggctgtcgttggcttcccgcatgacctgaaaggcgaagggatctgctgcttcgtg
accctcaaagggggcgaaggctcggaggaagttcgcaaagagctgattcagcacgtccgc
aagcagatcggtgcgatcgccacaccggatcaaatccgcttcgcagctgcgttgccgaaa
acccgttccggcaaaattatgcggcgtctgctccgcgatatcgcagccggccgtgaatct
gcgggtgataccaccacgctcgaagactacaccgtgcttgccacgctgcgggaaagtgac
gccagctaa

DBGET integrated database retrieval system