KEGG   Planctomyces brasiliensis: Plabr_2227Help
Entry
Plabr_2227        CDS       T01431                                 

Definition
carboxypeptidase Taq (EC:3.4.17.19)
Orthology
K01299  
carboxypeptidase Taq [EC:3.4.17.19]
Organism
pbs  Planctomyces brasiliensis
Brite
Enzymes [BR:pbs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.19  carboxypeptidase Taq
     Plabr_2227
Peptidases [BR:pbs01002]
 Metallo Peptidases
  Family M32: carboxypeptidase Taq family
   Plabr_2227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2632837..2634348
Genome map
AA seq 503 aa AA seqDB search
MEETYRELTTYLRRLALLGSSNSLLSWERETFMPEGGTQLRSEQVSLLAGVQHQWATAPR
LGELLDELIEADLGPADGPMAVNVRQAKRDYDLATKLPQRLVEDLSRVTTLSQGAWHRAK
QSNDFSAFEPWLDQVLTLKREEADCLRAGADAPLYDSLLDQYEPGMTTDQLKATFGPLRE
QLVPLVSAIADASDKPAADILNRDFPIDQQQAFSRKAAAAIGFDLDSGRIDESAHPFCSG
IGPGDCRLTTRYDEQFFNMAFFGTLHEAGHGIYEQGLNPEAFGLGMGQSVSLGIHESQSR
MWENLVGRSHAFWHHFYPEAQERYAALKDVPLEQFYRSINLVEPSWIRVEADEVTYNLHI
MLRFELEQQLVAGDLKTADLPEAWNALFREYFGITPPDDAHGCLQDVHWSAGLFGYFPTY
ALGNIYAAQFYNAAERELGNLHDLFASGQFAPLKDWLNKNIHSRGQQYLAADLVKVVTGE
EFSADPLLQYLNHKFGEVYRLSN
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggaagagacgtaccgcgaattgacgacttaccttcgccgattggcgttgctcggctcc
tcgaacagcctgttgagctgggagcgggaaaccttcatgccggaaggcggaacgcagctg
cgttccgaacaggtcagcctgctcgcgggggtgcagcatcaatgggcgactgcacctcgt
ctgggcgaattgctggacgaactgatcgaggcagaccttggccccgccgatggcccgatg
gccgtcaatgtgcggcaggccaaacgcgattacgatctggcgaccaaactgccacaacgc
ctggttgaagacctgtctcgtgttaccacgctgtcccagggagcgtggcatcgcgcgaaa
cagtccaacgatttttccgcgttcgagccgtggctggatcaggttctgaccttgaaacgg
gaagaggccgactgcctgcgggcaggggcggatgctccgctgtacgattctctgctcgat
cagtacgaaccgggcatgacgaccgaccaactgaaagcgacattcggtccgctgcgcgaa
caactcgttccgctggtttccgcgattgccgacgccagcgataagccggctgccgatatt
ctcaaccgcgattttcccattgatcagcaacaggctttctccagaaaggccgccgcggcc
atcggattcgatttggattccggccgcattgatgaatctgcccatccattctgcagtgga
attggaccgggagattgtcggctgacgacccgatacgacgagcagttcttcaacatggcc
ttcttcggcacgttgcatgaagcagggcacggcatttacgagcagggcctgaatcctgaa
gcgtttggcctgggcatggggcaatctgtctcgttgggcattcacgaatcgcagtcccgc
atgtgggaaaaccttgtcggccgctcgcacgcgttctggcaccatttctatccggaagct
caagaacgttacgccgccctgaaagacgtcccgctggaacaattctaccggtccatcaat
ctggtagaaccatcttggattcgcgttgaagcggacgaggtgacctacaacctgcacatc
atgctgcggtttgagctggaacagcagttggttgcgggcgacttgaaaacggctgatctg
ccggaagcgtggaatgctctgttccgcgaatacttcggtatcaccccgccagacgatgcg
cacggctgcctgcaggatgtccactggtcggctggtttgttcggctacttccccacctat
gcgttggggaatatttacgctgcacagttctacaacgccgccgaacgtgagctgggcaat
ttgcacgacctgttcgcttccggccagttcgcaccgctcaaagactggctgaacaagaac
atccacagccgtgggcagcaatatctggcagccgatctggtgaaagtggtcaccggagaa
gagttcagtgccgacccgctgctgcagtacttgaatcacaaattcggcgaagtctaccgc
ctttcaaattaa

DBGET integrated database retrieval system