KEGG   Planctomyces brasiliensis: Plabr_2332Help
Entry
Plabr_2332        CDS       T01431                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pbs  Planctomyces brasiliensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:pbs01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:pbs01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pbs00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pbs00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:pbs00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pbs00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:pbs00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2778486..2779784
Genome map
AA seq 432 aa AA seqDB search
MAKNMIVAQSGGPSPVINNTLRGIVETAREMSEIGTVYGGWHGIEGVLKEELLDLTAQCP
DEIALLRTTPAAGSIGTCRYKLKDHQNEDFDRIIDIFKAHNIGYFVYIGGNDSMDTANKV
ANVARERGLDVVGIGGPKTIDNDVGDSEFQLIDHTPGYGSTARYWSNYIQMSNEENNGSC
PADPVLVLQAMGRKIGYIPAAARLADPKREMPLQIYLAERKVTIEQMRENINTMLKEHGR
AMVVVSEGLEIEGLEIPEEFVVRDSFGHAMLSSSKITVGQLLTNALNEEPLAVKGKARCN
VPGTHQRNDIIHASNVDLTESYYVGQKAALLAAGGEHGYMASILRADRENYTVEYGKAPL
SEVANSERHFPQEWITKCGTDVTDEFVKYARPLIGDNWVSVPVIDGRLRLARMKPIFADQ
KLDKYIPQADRS
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaatatgattgtggctcagtccggcggtccgtcgccggtcatcaacaatact
ctgcggggtattgtggaaaccgcccgggaaatgtccgaaatcggcaccgtctacggtggc
tggcacggcatcgaaggggttctgaaagaagaactgctcgacctgaccgcccagtgcccg
gacgaaattgcgttgctgcgaaccacgccagccgctggttctatcggtacctgccgctac
aagctgaaagatcaccagaacgaagatttcgatcgcatcatcgacatcttcaaagctcac
aacattggctacttcgtctacatcggcggtaacgattcgatggacaccgccaacaaagtc
gccaacgtggcccgcgaacgcggcctggacgtggttggcattggcggcccgaaaacgatt
gacaacgatgtcggggacagcgaattccagctcatcgaccacactcctggttacggcagc
accgcccgttactggagcaactacatccagatgtccaacgaggaaaacaacggcagctgc
ccggctgaccctgtcctcgtgctgcaggcgatgggccggaaaatcggctacatccctgct
gccgcgcgtctggctgacccgaaacgcgaaatgccgctgcagatttatctggccgagcga
aaagtcaccatcgagcagatgcgtgagaacatcaacaccatgctcaaagagcacggccgg
gcgatggttgtcgtcagcgaaggtctggaaatcgaaggcctcgaaattccggaagaattc
gtcgtccgcgactctttcggccacgcgatgctttcttccagcaaaatcaccgtcggtcag
ctgctgaccaacgctctcaacgaagagccgctggctgtcaaaggcaaagctcgctgcaac
gtgcccggcacccaccagcggaacgacatcattcatgcttctaacgtcgacctgaccgag
tcttactacgtcggccagaaagctgctttgctggcagctggaggcgagcatggttacatg
gcttcaattctgcgggccgaccgcgagaactacaccgtcgaatacggcaaggctccgctg
tctgaagtcgccaacagcgaacgccacttcccccaggagtggatcaccaaatgtggtacg
gacgtgaccgacgaattcgtcaaatacgcccgtccgcttatcggcgacaactgggtcagc
gttcccgtcatcgatggtcgtctgcgtctggctcgcatgaagccaatcttcgccgaccag
aaactcgacaaatacatcccgcaggccgaccgctcctag

DBGET integrated database retrieval system