KEGG   Rubinisphaera brasiliensis: Plabr_2332Help
Entry
Plabr_2332        CDS       T01431                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
pbs  Rubinisphaera brasiliensis
Pathway
pbs00010  Glycolysis / Gluconeogenesis
pbs00030  Pentose phosphate pathway
pbs00051  Fructose and mannose metabolism
pbs00052  Galactose metabolism
pbs00680  Methane metabolism
pbs01100  Metabolic pathways
pbs01110  Biosynthesis of secondary metabolites
pbs01120  Microbial metabolism in diverse environments
pbs01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pbs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Plabr_2332
   00030 Pentose phosphate pathway
    Plabr_2332
   00051 Fructose and mannose metabolism
    Plabr_2332
   00052 Galactose metabolism
    Plabr_2332
  Energy metabolism
   00680 Methane metabolism
    Plabr_2332
Enzymes [BR:pbs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Plabr_2332
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Plabr_2332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Fe-ADH
Motif
Other DBs
NCBI-ProteinID: ADY59934
UniProt: F0SM09
Position
2778486..2779784
Genome map
AA seq 432 aa AA seqDB search
MAKNMIVAQSGGPSPVINNTLRGIVETAREMSEIGTVYGGWHGIEGVLKEELLDLTAQCP
DEIALLRTTPAAGSIGTCRYKLKDHQNEDFDRIIDIFKAHNIGYFVYIGGNDSMDTANKV
ANVARERGLDVVGIGGPKTIDNDVGDSEFQLIDHTPGYGSTARYWSNYIQMSNEENNGSC
PADPVLVLQAMGRKIGYIPAAARLADPKREMPLQIYLAERKVTIEQMRENINTMLKEHGR
AMVVVSEGLEIEGLEIPEEFVVRDSFGHAMLSSSKITVGQLLTNALNEEPLAVKGKARCN
VPGTHQRNDIIHASNVDLTESYYVGQKAALLAAGGEHGYMASILRADRENYTVEYGKAPL
SEVANSERHFPQEWITKCGTDVTDEFVKYARPLIGDNWVSVPVIDGRLRLARMKPIFADQ
KLDKYIPQADRS
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagaatatgattgtggctcagtccggcggtccgtcgccggtcatcaacaatact
ctgcggggtattgtggaaaccgcccgggaaatgtccgaaatcggcaccgtctacggtggc
tggcacggcatcgaaggggttctgaaagaagaactgctcgacctgaccgcccagtgcccg
gacgaaattgcgttgctgcgaaccacgccagccgctggttctatcggtacctgccgctac
aagctgaaagatcaccagaacgaagatttcgatcgcatcatcgacatcttcaaagctcac
aacattggctacttcgtctacatcggcggtaacgattcgatggacaccgccaacaaagtc
gccaacgtggcccgcgaacgcggcctggacgtggttggcattggcggcccgaaaacgatt
gacaacgatgtcggggacagcgaattccagctcatcgaccacactcctggttacggcagc
accgcccgttactggagcaactacatccagatgtccaacgaggaaaacaacggcagctgc
ccggctgaccctgtcctcgtgctgcaggcgatgggccggaaaatcggctacatccctgct
gccgcgcgtctggctgacccgaaacgcgaaatgccgctgcagatttatctggccgagcga
aaagtcaccatcgagcagatgcgtgagaacatcaacaccatgctcaaagagcacggccgg
gcgatggttgtcgtcagcgaaggtctggaaatcgaaggcctcgaaattccggaagaattc
gtcgtccgcgactctttcggccacgcgatgctttcttccagcaaaatcaccgtcggtcag
ctgctgaccaacgctctcaacgaagagccgctggctgtcaaaggcaaagctcgctgcaac
gtgcccggcacccaccagcggaacgacatcattcatgcttctaacgtcgacctgaccgag
tcttactacgtcggccagaaagctgctttgctggcagctggaggcgagcatggttacatg
gcttcaattctgcgggccgaccgcgagaactacaccgtcgaatacggcaaggctccgctg
tctgaagtcgccaacagcgaacgccacttcccccaggagtggatcaccaaatgtggtacg
gacgtgaccgacgaattcgtcaaatacgcccgtccgcttatcggcgacaactgggtcagc
gttcccgtcatcgatggtcgtctgcgtctggctcgcatgaagccaatcttcgccgaccag
aaactcgacaaatacatcccgcaggccgaccgctcctag

DBGET integrated database retrieval system