KEGG   Rubinisphaera brasiliensis: Plabr_2531Help
Entry
Plabr_2531        CDS       T01431                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pbs  Rubinisphaera brasiliensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pbs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Plabr_2531
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Plabr_2531
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Plabr_2531
Enzymes [BR:pbs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Plabr_2531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3019757..3021160
Genome map
AA seq 467 aa AA seqDB search
MTATTSDFASAAYQACLLPKHEETYSVSEARPHGMANDLLDIQYDWDRIPVPSSLKEFEK
RWSTRNNPLDYSGVWRFRELFPFAPEDQIVTIGEGQTVLQKNDGVAKYAGVNAGGLFLQY
EGMNPSGSFKDNGMTAASTHARMIGAKVTACASTGNTSASLAIYGGVTGLFKVVVFVGSG
KIAYGKLSQALDYGAATLQIQGDFDDALKQVRRVCAESGIYLCNSVNPFRLEGQKSIMYR
VLEGLNWEVPDWIVVPGGNLGNSSAFGKAFIELKQLGLIDRMPRLAVINAAGASTLTKLY
NEHGLRWNNGDPCETTIGDYFTKMDNEDGRAVTLASAIEINRPVNLTKCLRALDACDGVV
RDVSDEQILDAKAQVGRFGFGCEPASGASVAGAKMLREEGIIAPSDRVVCILTGHQLKDP
NATVAYHSGDKDALAKSGPVEPHFGNAPIPVDNDFDAIMQVIDSLSS
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccactacgtccgatttcgcctccgcagcctatcaggcctgcctgttgccgaag
cacgaagaaacttattctgtttccgaagcgcgtccgcacggaatggcgaacgacctgctc
gatattcagtacgactgggatcgcattccggttccgagcagtctgaaggaattcgagaaa
cgctggagcacccgcaataatccgctcgattacagcggcgtgtggcggttccgcgagttg
tttccgttcgctccggaagaccagattgtcaccatcggagaagggcagaccgttctgcag
aaaaacgacggcgttgccaaatacgccggagtcaacgcgggcggactgttcctccagtac
gaagggatgaacccctccggcagcttcaaagacaacggcatgaccgctgcttcaactcat
gctcgcatgatcggagcgaaagtcaccgcctgtgcttcaaccggtaataccagcgcgtcg
ctcgccatttacggcggcgtgaccggactgttcaaagtggtcgtgttcgtcggttcggga
aaaatcgcctacggcaagctgtctcaggctcttgattacggagccgccacgctgcagatt
caaggggacttcgacgacgcgttgaagcaggtccgccgcgtttgtgcagaatccggaatc
tacctgtgtaacagcgtgaatcccttccgtttggaggggcagaagtcgatcatgtatcgc
gtgctcgaagggttgaactgggaagtgccagactggattgtcgtacccggcggcaacctg
gggaactccagtgcgttcggcaaagcgttcatcgaactgaagcagctcggactgatcgat
cgcatgccgcgactggccgtcatcaatgcagccggcgcgagcacgctgaccaagttgtat
aacgagcatggcctccgctggaacaacggcgatccgtgtgaaacgaccatcggtgactac
ttcaccaaaatggacaacgaagatgggcgggcggtcacgctagcgtccgcgatcgaaatc
aatcgtccggtcaatctgaccaagtgtctgcgggcgttggatgcctgtgacggtgttgtt
cgcgacgtctccgacgagcagattctcgacgccaaagcccaggtgggccgtttcgggttt
ggttgcgaacctgccagcggtgccagcgttgccggggcgaaaatgctgcgggaagaaggc
atcatcgctccgtccgatcgcgtcgtctgtatcctgacggggcatcaattgaaagatccg
aacgcgacggtggcctatcattccggggataaagacgctctggcgaagtcgggccctgtc
gagccgcacttcggcaatgccccgattccggtcgacaacgacttcgatgccatcatgcag
gtcatcgactccttgtcctcctga

DBGET integrated database retrieval system