KEGG   Planctomyces brasiliensis: Plabr_2568Help
Entry
Plabr_2568        CDS       T01431                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
pbs  Planctomyces brasiliensis
Brite
Enzymes [BR:pbs01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Plabr_2568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3071960..3073219
Genome map
AA seq 419 aa AA seqDB search
MKIPNVPKRFALAALASLGFAVACDLPVQAASKSDAKSNRVTLGQSGLVGGIPGEGPLTN
AEIKKWLADPANHETLEVVLPLGLNVANIPEGVLEANPLTRAKVELGRQLYFDTRLSVDN
TISCASCHDPEVGWAANTQFGVGIEGLQGNRNSPVSYNRILTKEQFWDGRAASLEDQAIG
PIANPIEMGNTHEAAVGVIGKIPGYRLQFESIFGKDGVTIENVGKALAAFERVIVTNPTP
YDYYEQLKPFSRFEPEDIEDDPDLKEMYDEAAALSAAHPMSESAIRGRDLFFSERVNCAA
CHVGANLADEKYYNLGVGMDKENPDLGRYEVTGKEEDKGAFKTPTIRNVAQTAPYMHDGS
LKTLMDVVEHYNKGGIPNPHLSDKIVKLNLTEQEKKDLVAFMEACTGEFEEVEPGRLPK
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaagattccgaacgttccgaaacgattcgccctggcagctctggcttcactgggcttt
gcagtcgcctgcgatctgcccgtgcaggccgcctcaaaaagcgacgccaaatccaatcgt
gtcaccctcggtcaatccggcctggtcggcggtattcccggcgaaggcccgctgacgaat
gctgagatcaaaaaatggttggccgatcccgccaatcacgaaactctcgaagtggttctg
cctctcgggttgaatgtggccaacattcctgaaggcgtgctcgaagccaatccgctcacc
cgcgctaaagtggagctgggacgccagctgtatttcgacacgcgtttgtcggtcgataat
acgatcagctgcgcttcctgccacgatccagaagtcggctgggctgccaatacgcagttc
ggagttgggattgagggactgcagggaaatcgtaactcgccagtcagttacaaccgcatt
ctgacgaaagaacaattctgggacggccgggctgcctcgctggaagatcaggcgatcggc
ccgattgccaacccgatcgaaatggggaatacccacgaagcagctgtcggcgtgatcggc
aagatccccggctatcgtctgcagttcgagtcgattttcggcaaagacggcgtgaccatc
gaaaacgtcggcaaggctctggctgccttcgagcgtgtcatcgtcaccaacccgacccct
tacgattactacgagcagctgaaaccgttctcacgcttcgagccggaagacatcgaagac
gatcccgatttgaaagagatgtacgacgaagcagcggcgttgtcagccgctcatccgatg
tcggagtcagccattcgcggacgggatctgttcttcagtgaacgagtcaactgcgctgcc
tgtcacgtgggagccaacctggctgacgagaagtactacaacctcggcgtcggcatggac
aaagagaatcccgatctgggccgttacgaagtgaccggcaaagaagaggacaagggagct
ttcaaaacgccgacaattcggaacgtcgcccagacggctccttacatgcacgacggcagc
ttgaaaacgctgatggatgttgtcgagcattacaacaagggcggtattccaaacccgcac
ttgagcgacaagatcgtgaagctgaatctgaccgagcaggaaaagaaagacctggtcgcg
ttcatggaagcctgcaccggagaatttgaagaagtcgaacccggccgtctgccgaagtag

DBGET integrated database retrieval system