KEGG   Planctomyces brasiliensis: Plabr_2840Help
Entry
Plabr_2840        CDS       T01431                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pbs  Planctomyces brasiliensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pbs00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Plabr_2840
Enzymes [BR:pbs01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Plabr_2840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3416288..3417091)
Genome map
AA seq 267 aa AA seqDB search
MTVRVCSFESRRCEEMESMISRFGGNPTVAPSMREVPLEENVIAEEFATRLCNGEFEVVV
FMTGVGASTLFEAVQKTSDWDKFHAALDKRMILVRGPKPVPVLRSHKVHIDYRAPEPNTW
RELLAGIDSEQIDLKGKTVAIQEYGKPNQDFYDELAARGATVYPVPVYRWEFPTDLEPLN
GAIRESVETGFDVVMFTSANQVDNVLEAARRLELEDKFRLSLKNACIASIGPTCSERLVE
LGLPPAFEPSHPKMAHLIREALEFAQK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttcgtgtatgcagctttgaatcgcgccgttgcgaggaaatggaatcgatgatt
tcccgctttggaggaaacccaactgtcgcgccttccatgcgcgaggttcctctggaagag
aacgtgatcgctgaagaattcgccacgcgtttgtgcaatggtgagtttgaagttgtcgtc
tttatgacgggcgtgggggcgagcacactgtttgaagcggtgcagaaaacgagcgactgg
gacaagttccacgccgctctggacaaacggatgattctggttcgcggaccgaaacccgtt
cccgtccttcgcagccacaaggtgcacatcgactaccgggctccggaaccaaatacatgg
cgcgaactgctcgccgggatcgacagcgagcagattgacctgaaaggcaagaccgtcgcc
attcaggaatatggaaagccgaaccaggacttttacgacgaactcgccgcccggggcgca
accgtttacccggtgcccgtctatcgctgggagtttccgaccgatctggagccgttgaac
ggagcgattcgcgagtcggtcgaaaccggtttcgacgtggtaatgttcacaagcgccaac
caggtcgacaacgtgctcgaagccgcccggcgattagaactcgaagacaagttccgcctg
tcgcttaagaatgcctgcattgcctcaattgggccgacctgcagcgaacggctggttgaa
cttggtttgcctccagcctttgagccaagccacccaaagatggctcacctcattcgcgaa
gccctggaattcgcccagaaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system