KEGG   Rubinisphaera brasiliensis: Plabr_2855Help
Entry
Plabr_2855        CDS       T01431                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pbs  Rubinisphaera brasiliensis
Pathway
pbs00020  Citrate cycle (TCA cycle)
pbs00640  Propanoate metabolism
pbs00660  C5-Branched dibasic acid metabolism
pbs01100  Metabolic pathways
pbs01110  Biosynthesis of secondary metabolites
pbs01120  Microbial metabolism in diverse environments
pbs01130  Biosynthesis of antibiotics
pbs01200  Carbon metabolism
Module
pbs_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pbs_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pbs00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Plabr_2855
   00640 Propanoate metabolism
    Plabr_2855
   00660 C5-Branched dibasic acid metabolism
    Plabr_2855
Enzymes [BR:pbs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Plabr_2855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 ATP-grasp ATPgrasp_Ter GARS_A
Motif
Other DBs
NCBI-ProteinID: ADY60454
UniProt: F0SFJ4
Position
3434718..3435905
Genome map
AA seq 395 aa AA seqDB search
MKIHEYQAKQLFREAGVPVPRGIVAHSLDDVTQAFQQLGGALAVVKSQIHAGGRGKGTFK
EQPEQRGVVLVKSAGEAHENAGRMMGNTLVTIQTGEEGKQVNTLFVEEGLEIARELYLGI
VIDRESSCPVLIMSTEGGMEIEEVAEHSPEKIIREYFDVALGLLPYQARKMAFALGMEGK
TVRSAEKFLTKVCQFFIDNDCSMTEINPLIVTGDGELVALDAKVTFDDNALFRHKNLEPF
RDLSEEEPAEVKAQDAGLSYVKLDGNIGCLVNGAGLAMSTMDLIKLHGGEPANFLDVGGG
ATVDAVTEAFRIILADENVKAVLVNIFGGIMKCDVIVEALLTAYDKVGFHVPLVVRLEGT
NVEKAREMLAASGKDIITAENLTDAAKKVVGTLQG
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgaatatcaggcaaaacagctgtttcgcgaggcgggcgttccagtaccc
cgtggaatcgtggcccactccctcgacgatgtaacccaggcgtttcagcagctgggtggc
gcactggcggttgtgaaatcgcagattcacgccgggggacgcgggaagggcacgttcaaa
gaacagcccgagcaacgcggtgttgtcctggttaagtcagccggcgaagcccacgaaaat
gcaggccgcatgatgggcaatacgctggtcaccattcagactggcgaagaaggcaaacag
gttaatacgctcttcgttgaagaagggctcgaaattgctcgcgagttgtatctcggtatc
gtgattgaccgcgaatccagctgcccggtgttgatcatgtccaccgaaggcgggatggaa
atcgaagaagtggcagagcattctcccgagaaaatcattcgcgaatacttcgacgtcgct
ttgggactgctgccttatcaggctcgcaaaatggcctttgcattgggcatggaaggcaag
acggttcgttccgctgagaagttcctgaccaaagtctgtcagttcttcatcgacaacgac
tgcagcatgaccgaaatcaacccgctgatcgtcactggcgatggcgaactggttgctctc
gatgccaaagtgaccttcgacgacaacgcactgttccggcacaagaatctcgaaccgttc
cgcgatctttcggaagaagagccggccgaggtcaaagctcaggatgctggtctcagctac
gtgaaactggacggcaatattggctgtctggttaacggggcaggtctggccatgagtacg
atggacctgatcaaactccacggtggtgaaccggccaacttcctcgacgtcggtggcggg
gccactgttgatgcggttacggaagcgttccgcatcattctggccgacgaaaacgtcaaa
gcggtgctcgtcaacatcttcggcggcattatgaaatgtgatgtcatcgtggaagcgttg
ttgacagcctacgataaggtcggtttccacgtgccgctggtcgttcgcctcgaaggaacg
aacgtcgagaaggcccgtgagatgctcgccgcttccggcaaagatatcatcaccgcagaa
aacctgactgacgctgccaagaaagttgtgggcaccctgcaggggtaa

DBGET integrated database retrieval system