KEGG   Planctomyces brasiliensis: Plabr_2904Help
Entry
Plabr_2904        CDS       T01431                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pbs  Planctomyces brasiliensis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pbs00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3498024..3498719
Genome map
AA seq 231 aa AA seqDB search
MISSRQDSAVAEISNRDAAAATLNKSQSIEVMPEQNEEKSAANQPVDLESIKDAVRVILK
AVGEDPDRDGLLETPRRVAKMYAEMFAGLHKDAGRHLEVTFPETYDEMVLVRDISFTSMC
EHHLLPFSGVAHVAYLPDGAVTGLSKLARVVEEVSRRPQVQERMTQTVAELIETRLECRG
VAVVVEAEHSCMTIRGIRKPGSKTITSALRGEFKTNPASRAEVMSLINERR
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgatttcttcgcgacaagattcggctgtggctgaaatttccaaccgtgatgcagctgct
gccacacttaataaatcccagagtatcgaagtcatgcctgaacagaacgaagagaagtcc
gcggcaaatcaacctgtcgacctggagtcaatcaaggacgctgttcgagtcattctgaaa
gcggtcggcgaagatccagatcgtgatggtctgctcgaaaccccccgccgtgttgccaag
atgtacgcggaaatgttcgccggcctgcataaagatgcggggcgtcatctggaagtgacg
ttccccgagacttacgatgaaatggtgctcgttcgagatatctcgttcaccagtatgtgc
gagcatcacctcctgcccttctctggcgtagcgcatgtcgcttatctgcccgacggagcg
gtcacgggcttgagcaagctggcccgtgttgtcgaagaagtctcccggcgtcctcaggtt
caggaacggatgacgcaaaccgttgctgagctgattgaaacccgtctggaatgtcgtggg
gtggcggttgtggtcgaggccgagcattcctgcatgaccatccgcgggattcgcaaaccg
ggcagcaaaacgatcaccagcgctctccgcggagaattcaaaacgaatcccgccagccgc
gcggaagtgatgtcgttgattaacgagcggcgataa

DBGET integrated database retrieval system