KEGG   Planctomyces brasiliensis: Plabr_3326Help
Entry
Plabr_3326        CDS       T01431                                 

Definition
peroxiredoxin (EC:1.11.1.15 1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pbs  Planctomyces brasiliensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pbs00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:pbs00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4086786..4087403)
Genome map
AA seq 205 aa AA seqDB search
MIYDGATRFSTSFTSPERRPMKYFALCTLLSCLTFLSADAAEKSEVLDHKAQTLAGKEVD
LSKYDGKVVLIVNVASRCGATPQYEALQRLHETYKDRGLVVLGFPCNQFGRQEPGTAAEI
REFCTANYGVTFDMFSKIDVNGPDASPLYQHLTSEETNPEFAGNVRWNFEKFLISKDGKI
VNRFRTGVQPNSDVVIAAIEKELRK
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgatctatgatggagcaactcggttttcaaccagcttcacctcacctgaaagacgtccg
atgaagtatttcgctctctgcacgttgctgtcctgtttgaccttcctgtctgccgacgcc
gctgaaaagtcggaagtactggatcacaaggctcaaacgctggccggcaaagaagtcgac
ctgtcgaagtacgatgggaaagtggtgctcatcgtcaatgtggccagccgttgtggcgca
acaccgcagtatgaagctctgcagcgattgcacgaaacctacaaggatcgtgggcttgtc
gttctcggatttccttgcaaccagttcggccgtcaggagccggggactgccgctgagatt
cgcgagttctgcaccgccaattatggcgtgacgttcgatatgttctccaaaatcgatgtc
aacggcccagatgcttctccgctttaccagcacctgacttcggaagaaacgaatcctgag
ttcgccgggaacgtgcgttggaatttcgagaagttccttatttccaaagacggcaaaatt
gtgaaccgcttccggaccggcgtacagccaaactcggatgtcgtcatcgctgcgattgaa
aaagaacttcggaagtaa

DBGET integrated database retrieval system