KEGG   Planctomyces brasiliensis: Plabr_3531Help
Entry
Plabr_3531        CDS       T01431                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pbs  Planctomyces brasiliensis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pbs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Plabr_3531
  Amino acid metabolism
   00340 Histidine metabolism
    Plabr_3531
Enzymes [BR:pbs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Plabr_3531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4343855..4345228
Genome map
AA seq 457 aa AA seqDB search
MPAGNSVQIPTIRLADADAEALFEQLRDKLSPKGNVVSAAGRQRTIDTFGEPLTPQQVVA
RICGDVAEKGLEAVLDYGAKLDGKQLTAETIRVSEAELDEAHAAADDAFLETVRRVRDNV
AEFQNAILNRDVQLVRDLSPGRVELRQRYLPLKRVGICIPGGAAAYPSSLLMTAVPAQTA
GVSEIAVVAPPTEFGSYNVSLLAACREIGVTEVYRMGGAQAVAALAYGVEGLPRVDKIVG
PGNLFVALAKRHVFGDVDIDSIAGPSEVIVLADESANPAYVASDLISQAEHSPGSSVLIT
WHEPLIAAVQKALDEQLAQLSRGDLAHQALEDYGAFILADNAQQAAQLTDRLATEHLHIS
TADPEAMLAQVQNAGAIFLGHHTPVAMGDYVAGPSHVLPTGGTARFANGLCANDFLKRSS
IISYDPAALAADADDVRRLADLEGLTGHRHSVDIRLQ
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgccagcaggcaactccgttcagatccccaccatccgtctcgccgacgccgatgccgag
gccctttttgaacaactgcgcgacaaactcagcccgaaagggaacgtggtttccgccgcc
ggccgccagcgaaccattgacacttttggcgagccgctcacgccgcaacaggtggtcgct
cgtatttgtggcgatgtcgccgaaaaaggcctggaagcggttctcgactacggggccaag
ctcgacggcaaacagctgaccgctgaaacgatccgcgtttccgaggccgaactcgacgaa
gctcacgccgccgccgatgacgctttcctcgaaaccgtccgtcgcgttcgcgacaacgtg
gccgagtttcagaacgcgatcctcaaccgcgacgtccagctcgtccgcgatttaagcccc
ggccgggttgagctgcgtcagcgttatctgccactcaaacgggtcggcatctgcattccc
ggtggagcagccgcgtatccgtcgagcctgctgatgacagctgttccggctcagacggct
ggtgtttccgaaatcgccgtggtcgccccgccaaccgaattcggcagctataacgtcagc
ctgctggccgcctgccgtgaaattggcgtgaccgaagtgtaccgcatgggcggggctcaa
gcggtggctgctctggcatacggcgtggaaggactgccgcgcgtcgacaagattgtcggc
cctggaaacctgttcgtcgcgctcgccaaacgtcatgtctttggtgatgtcgatatcgac
agcatcgccggcccgagcgaagtgatcgtgcttgccgatgaatcggccaatccggcttat
gtcgccagcgatctcatttcacaagccgaacacagccccgggtcttccgtgttgatcacc
tggcatgaaccgctgattgcggcagtgcagaaagcactcgacgaacaactggcccagttg
tcgcgcggcgatctggctcatcaggcgctggaagattacggcgccttcattctggcagac
aacgcacagcaggcggcccaactgaccgaccgactggcgactgagcacttgcacatttcc
acagccgatcccgaagcgatgctcgctcaggtacagaacgccggggcaatttttctggga
caccacacccccgtggcgatgggcgactatgttgcagggccatcacacgtgcttccgacc
ggaggcacggcccgtttcgccaacggcttgtgtgcgaacgatttcctcaaacggtcttcc
atcatcagctacgacccggccgccctggccgcagatgccgacgatgtccgccgactggcc
gatctcgaaggcctgaccggtcaccgtcacagtgtcgacattcgtttacaataa

DBGET integrated database retrieval system