KEGG   Planctomyces brasiliensis: Plabr_3531Help
Entry
Plabr_3531        CDS       T01431                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
pbs  Planctomyces brasiliensis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pbs01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:pbs00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4343855..4345228
Genome map
AA seq 457 aa AA seqDB search
MPAGNSVQIPTIRLADADAEALFEQLRDKLSPKGNVVSAAGRQRTIDTFGEPLTPQQVVA
RICGDVAEKGLEAVLDYGAKLDGKQLTAETIRVSEAELDEAHAAADDAFLETVRRVRDNV
AEFQNAILNRDVQLVRDLSPGRVELRQRYLPLKRVGICIPGGAAAYPSSLLMTAVPAQTA
GVSEIAVVAPPTEFGSYNVSLLAACREIGVTEVYRMGGAQAVAALAYGVEGLPRVDKIVG
PGNLFVALAKRHVFGDVDIDSIAGPSEVIVLADESANPAYVASDLISQAEHSPGSSVLIT
WHEPLIAAVQKALDEQLAQLSRGDLAHQALEDYGAFILADNAQQAAQLTDRLATEHLHIS
TADPEAMLAQVQNAGAIFLGHHTPVAMGDYVAGPSHVLPTGGTARFANGLCANDFLKRSS
IISYDPAALAADADDVRRLADLEGLTGHRHSVDIRLQ
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgccagcaggcaactccgttcagatccccaccatccgtctcgccgacgccgatgccgag
gccctttttgaacaactgcgcgacaaactcagcccgaaagggaacgtggtttccgccgcc
ggccgccagcgaaccattgacacttttggcgagccgctcacgccgcaacaggtggtcgct
cgtatttgtggcgatgtcgccgaaaaaggcctggaagcggttctcgactacggggccaag
ctcgacggcaaacagctgaccgctgaaacgatccgcgtttccgaggccgaactcgacgaa
gctcacgccgccgccgatgacgctttcctcgaaaccgtccgtcgcgttcgcgacaacgtg
gccgagtttcagaacgcgatcctcaaccgcgacgtccagctcgtccgcgatttaagcccc
ggccgggttgagctgcgtcagcgttatctgccactcaaacgggtcggcatctgcattccc
ggtggagcagccgcgtatccgtcgagcctgctgatgacagctgttccggctcagacggct
ggtgtttccgaaatcgccgtggtcgccccgccaaccgaattcggcagctataacgtcagc
ctgctggccgcctgccgtgaaattggcgtgaccgaagtgtaccgcatgggcggggctcaa
gcggtggctgctctggcatacggcgtggaaggactgccgcgcgtcgacaagattgtcggc
cctggaaacctgttcgtcgcgctcgccaaacgtcatgtctttggtgatgtcgatatcgac
agcatcgccggcccgagcgaagtgatcgtgcttgccgatgaatcggccaatccggcttat
gtcgccagcgatctcatttcacaagccgaacacagccccgggtcttccgtgttgatcacc
tggcatgaaccgctgattgcggcagtgcagaaagcactcgacgaacaactggcccagttg
tcgcgcggcgatctggctcatcaggcgctggaagattacggcgccttcattctggcagac
aacgcacagcaggcggcccaactgaccgaccgactggcgactgagcacttgcacatttcc
acagccgatcccgaagcgatgctcgctcaggtacagaacgccggggcaatttttctggga
caccacacccccgtggcgatgggcgactatgttgcagggccatcacacgtgcttccgacc
ggaggcacggcccgtttcgccaacggcttgtgtgcgaacgatttcctcaaacggtcttcc
atcatcagctacgacccggccgccctggccgcagatgccgacgatgtccgccgactggcc
gatctcgaaggcctgaccggtcaccgtcacagtgtcgacattcgtttacaataa

DBGET integrated database retrieval system