KEGG   Planctomyces brasiliensis: Plabr_4083Help
Entry
Plabr_4083        CDS       T01431                                 

Definition
L-fuculose phosphate aldolase (EC:4.1.2.17)
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
pbs  Planctomyces brasiliensis
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pbs00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Plabr_4083
Enzymes [BR:pbs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Plabr_4083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5052422..5053327
Genome map
AA seq 301 aa AA seqDB search
MENRWNSGIHDRKLKEQICEIGRRVYDKGFAAANDGNISIRVGDNEVLCSPTMICKGFMT
PDDICAVDMNGDQLAGKRKRTSEVLLHLAIMKERPDVKAVVHCHPPHATAFAVAREAIPQ
CVLPEVEVFMGEVPLAPYETPGGQEFASTVVPFLKATNTIILTNHGTVSFGKTLEEAYWK
TEILDAYCRILILAKQIGGITYLGEQKSRELIDLKKRLGFDDPRFHNESCDLCGNSAFRD
GYKEDAPQQKAFEKAPEYPGYLQKPTYDSGNGNGNIQLPAGMNMDDLVKMITDQVVSAMG
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatcgctggaactcaggcattcacgatcgcaagctcaaagaacagatctgcgaa
atcggccgtcgcgtttacgacaaaggcttcgccgctgccaacgacggcaacatctcaatt
cgtgtcggggacaacgaagttctctgctcaccgaccatgatctgcaaaggtttcatgacg
ccggacgacatctgtgccgtcgacatgaatggcgatcagctggctggcaagcggaaacgg
accagcgaagtgctgctccacctggcgatcatgaaagaacggcccgacgtgaaagccgtc
gtccactgccacccgccgcacgccaccgcattcgctgttgctcgcgaagcgattccgcag
tgcgtgctgccggaagtcgaagtcttcatgggcgaagtgccactcgctccttacgaaact
cccgggggacaggaattcgcttccacggtcgtgccgttcctgaaagcgacgaacaccatc
attctgaccaaccatggcacggtcagctttggcaaaacgttggaagaagcctactggaaa
acggaaatcctcgacgcttactgccgcatcctgattctggccaaacagattggcggaatc
acttacctgggtgagcagaaaagccgtgagctgatcgacctgaagaaacgcctcggcttc
gacgatcctcgtttccacaacgagagctgcgatttgtgcggcaacagcgccttccgcgat
ggctacaaagaagacgccccgcagcagaaagcgtttgaaaaagctcccgaatacccgggt
tacctgcagaaaccgacttatgattcaggtaacggcaatggcaacattcagctgccagcc
ggcatgaacatggacgatctggtgaaaatgatcaccgatcaggttgtttctgccatgggc
aaataa

DBGET integrated database retrieval system