KEGG   Planctomyces brasiliensis: Plabr_4349Help
Entry
Plabr_4349        CDS       T01431                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pbs  Planctomyces brasiliensis
Brite
Enzymes [BR:pbs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Plabr_4349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5401582..5402253)
Genome map
AA seq 223 aa AA seqDB search
MTSDVDELVEELQAQGISDSRVLAVLKETPRELFLPPRLQSSAYENRALPIDCNQTISQP
YIVALMTEALGLTTGEERVLEIGTGSGYQTAILAQLCGHVYTIERWPPLASTARQLLTKL
ELENISYFAGDGTLGLEGHAPYDGIVVAAAARQVPACYWEQLRLGGRLIMPIGDEQGQQL
LRHEKTLDGWQTELLCPCRFVKLIGRHGWPAQPDEPPESLKPE
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgacttccgacgttgatgaactcgttgaggaattacaggctcaggggatttccgattcg
cgagtgctcgcggtgctgaaagaaacaccgcgcgagctgtttctaccccctcgcttacag
tcttccgcttacgaaaatcgcgccctgccgattgattgcaatcaaaccatcagccagccg
tacattgtggcattgatgaccgaagcgctggggctgacaactggcgaagagcgtgtgctt
gagatcgggaccggaagcggctatcagactgcgattctcgctcagctttgcggccatgtt
tatacgattgagcgttggcccccattggcgagcacggctcgacaattgttgacgaagctt
gagctggagaacatctcctatttcgcaggagatggcacgctgggacttgagggtcatgcg
ccttacgacggaatcgttgtggccgcagctgcccgtcaggttccggcctgttactgggag
caattaaggcttggcggccggctgattatgccaattggcgatgagcaaggccagcagttg
ttgcggcatgagaagacgttggatggatggcagaccgagctgctctgtccgtgtcgtttc
gtgaaactgattggccggcacggctggcctgcacaaccggacgagccgccagaatcgctt
aagcccgaataa

DBGET integrated database retrieval system