KEGG   Rubinisphaera brasiliensis: Plabr_4359Help
Entry
Plabr_4359        CDS       T01431                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pbs  Rubinisphaera brasiliensis
Pathway
pbs00230  Purine metabolism
pbs01100  Metabolic pathways
Module
pbs_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pbs00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Plabr_4359
Enzymes [BR:pbs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Plabr_4359
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 AAA_18 dNK AAA_28 MMR_HSR1 Cytidylate_kin2 AAA_22 AAA AAA_29 RsgA_GTPase AAA_17 AAA_5 Glyoxalase_3 ABC_tran SRPRB Zeta_toxin AAA_23 AAA_24 Rad17 TsaE T2SSE cobW APS_kinase NACHT NTPase_1 AAA_14
Motif
Other DBs
NCBI-ProteinID: ADY61932
UniProt: F0SKF1
Position
5415593..5416222
Genome map
AA seq 209 aa AA seqDB search
MTNSPANATSAQRPETPFCIVVLSGPSGSGKTTIVSRLEAESPVPLVKSVSATTRAPRKH
EVDGQDYYFLAPEEFEQRRARGEFLEYAEVFRTGCWYGTLKSELDRARKQSAWALLEIDV
EGAQNVMQQYPDALTIFLTTPSVDEFERRLRARGTEEEHVIQRRLETARRELEFANRYQH
QVVNDNLDRAVAEIKSIFDNKLRECCEHA
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
ttgaccaattcacctgcgaacgcgacttcggcccaacgtcccgaaacgcccttctgcatt
gtggttttgtccggtcccagtggcagtggcaagacgacaatcgtttcccgcctggaagct
gaatcgcccgtcccgttggtgaagtccgtttccgccaccacgcgggcaccacgaaaacac
gaagtcgacgggcaagattattatttcctcgctccggaagaatttgaacaacgtcgcgca
cggggcgagtttctcgaatacgcagaggtattccgcacaggctgctggtacggcaccttg
aaatcagaactggatcgtgcccgcaaacaaagtgcctgggccttgctggagatcgacgtc
gagggggcgcaaaatgtcatgcagcaataccccgacgcattgacgattttcctcacgacg
ccctccgtcgatgaattcgagcgtcgactgcgagcccgcggaacagaagaagaacatgtc
attcaacggcgactggaaacggctcgacgtgagctggagttcgccaatcggtatcagcat
caggtcgtcaatgacaacctggatcgagccgtcgccgagatcaaatccattttcgacaac
aaactcagggagtgctgcgaacatgcttga

DBGET integrated database retrieval system