KEGG   Planctomyces brasiliensis: Plabr_4359Help
Entry
Plabr_4359        CDS       T01431                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pbs  Planctomyces brasiliensis
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pbs00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5415593..5416222
Genome map
AA seq 209 aa AA seqDB search
MTNSPANATSAQRPETPFCIVVLSGPSGSGKTTIVSRLEAESPVPLVKSVSATTRAPRKH
EVDGQDYYFLAPEEFEQRRARGEFLEYAEVFRTGCWYGTLKSELDRARKQSAWALLEIDV
EGAQNVMQQYPDALTIFLTTPSVDEFERRLRARGTEEEHVIQRRLETARRELEFANRYQH
QVVNDNLDRAVAEIKSIFDNKLRECCEHA
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
ttgaccaattcacctgcgaacgcgacttcggcccaacgtcccgaaacgcccttctgcatt
gtggttttgtccggtcccagtggcagtggcaagacgacaatcgtttcccgcctggaagct
gaatcgcccgtcccgttggtgaagtccgtttccgccaccacgcgggcaccacgaaaacac
gaagtcgacgggcaagattattatttcctcgctccggaagaatttgaacaacgtcgcgca
cggggcgagtttctcgaatacgcagaggtattccgcacaggctgctggtacggcaccttg
aaatcagaactggatcgtgcccgcaaacaaagtgcctgggccttgctggagatcgacgtc
gagggggcgcaaaatgtcatgcagcaataccccgacgcattgacgattttcctcacgacg
ccctccgtcgatgaattcgagcgtcgactgcgagcccgcggaacagaagaagaacatgtc
attcaacggcgactggaaacggctcgacgtgagctggagttcgccaatcggtatcagcat
caggtcgtcaatgacaacctggatcgagccgtcgccgagatcaaatccattttcgacaac
aaactcagggagtgctgcgaacatgcttga

DBGET integrated database retrieval system