KEGG   Planctomyces brasiliensis: Plabr_4533Help
Entry
Plabr_4533        CDS       T01431                                 

Definition
dihydrolipoyllysine-residue acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pbs  Planctomyces brasiliensis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pbs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Plabr_4533
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Plabr_4533
   00020 Citrate cycle (TCA cycle)
    Plabr_4533
   00620 Pyruvate metabolism
    Plabr_4533
Enzymes [BR:pbs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Plabr_4533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5634525..5635859
Genome map
AA seq 444 aa AA seqDB search
MAIEFKLPEVSEGVESADIAELHVKEGDTITANQIVAEVETEKALAEIECPHAGRVAKVH
VSAGDSVAIGAVLLTIEESNGAESSDSGSKDDAPKAEEKQEEKKEESKPAEQKSAPAENK
QPASTSAPARQPSATVPADEDRAPAPAGPATRRLARDLGVDLYQVNGSGPGGRITQEDVQ
NYVKQRLTQPAAAAGGGGPIAPPPLPDFSEFGNTRREALNKIGKTAAQHLTTSWNVIPHV
TQHDLADITDIEMARKTFLAGPGKNGPKVTMTAIAIKAAVTALKAFPKFNSSLDPETNEI
VYKEYYNIGVAVDTENGLVVPVVKDVDKKSLVQIAADVTDLAVKARDRKLGMADMKGANF
TITNLGGIGGTAFTPIVSYPEVAILGMSRGQKQLSLIDGELEERLKLPLSLSYDHRVING
ADAARFIVKLSALLSDPFTLLSEC
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggctattgaatttaaacttcctgaagtgtcagaaggggtcgagtccgccgacatcgcc
gagctgcacgtcaaagagggagatacgatcaccgccaatcagattgtggcggaagtggaa
accgaaaaagcgctggcggaaattgaatgtccccacgcgggccgcgtcgccaaagtgcac
gtttccgccggtgacagtgtcgccattggcgctgtgctgttgaccatcgaagaatcgaac
ggggcggaatcttccgactccggctcgaaagacgatgctcccaaagcggaagaaaagcag
gaagagaagaaagaagaatcaaagccggccgagcagaaatccgctcctgcggaaaacaag
cagccagcctcaacttccgcgcctgcccgtcagccttccgcaactgttccggctgacgaa
gaccgggctcccgcaccagccggaccggcgactcgtcgtctggctcgcgatctgggtgtc
gacctgtatcaggtcaacggtagcggaccgggcggacgcatcactcaggaagacgtgcag
aactacgtgaaacagcggctgactcagccggctgcggctgctggtggtggcggcccgatc
gccccgcctccgctgcccgacttctccgagttcggcaacacgcgtcgtgaagcactcaac
aaaatcggcaagacggctgctcagcacctgacgacctcctggaacgtcattccgcacgtc
acccagcacgatctggctgacatcaccgatatcgaaatggcacggaaaaccttcctggca
ggccccggcaaaaacggcccgaaagtgacgatgaccgccatcgccatcaaggccgccgtg
accgctttgaaagccttcccgaagttcaactccagcctcgatcccgaaaccaacgagatc
gtctacaaggagtactacaacatcggcgtggccgtcgacaccgagaatggcctggtcgtg
cccgtcgtcaaagatgtcgacaagaagtctctggtgcagatcgccgccgacgtgaccgac
ctggctgtcaaagcccgcgatcgcaaactcggcatggccgacatgaagggtgccaacttc
accattaccaacctgggtggcattggcggcacggctttcacgccgatcgtcagctatccg
gaagtggcgattctgggcatgtctcgcggtcagaaacaactcagcctgatcgacggagaa
ctcgaagaacggctgaaactgccgctgtctctctcctacgatcaccgggtcattaacggg
gccgacgccgctcgcttcattgtgaagctgtctgccctgctctccgatccgttcactctg
ttgtcagagtgctaa

DBGET integrated database retrieval system