KEGG   Planctomyces brasiliensis: Plabr_4718Help
Entry
Plabr_4718        CDS       T01431                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pbs  Planctomyces brasiliensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pbs00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Plabr_4718
DNA repair and recombination proteins [BR:pbs03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Plabr_4718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5863947..5864558)
Genome map
AA seq 203 aa AA seqDB search
MEQQSHPYGPSVARLVDEFAEMPGIGRKSAERLAQYVVNLKKPAAARLIQAIDAVKRSIR
RCDVCHTLTEAETCEICSDPRRESSLVCVVEQPRDVISLEASGVFQGKYHVLHGCLSPLN
GIGPEQLTLDSLVKRVREHGVTEIVMATNPTLEGDGTALFISNLLADDNVRITRLARGIA
SGSVLEFANKEMLADALRGRQSF
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggaacagcagtctcatccttatgggccgagtgtggcccggctggttgacgaattcgcc
gaaatgcccggcatcggtcgcaagtcggccgaacggctggcgcaatacgtcgtcaatttg
aagaaaccggcggcagcccgattgattcaagcaattgatgccgtaaaacggagtattcga
cgctgtgacgtctgtcatacgctgaccgaagcggagacctgcgaaatctgtagcgatccc
cgccgtgaaagcagcctcgtttgtgttgttgaacagcctcgcgatgtgatttctctcgag
gcttctggcgtttttcaggggaaataccatgtcctgcatggctgcctgtccccgctgaat
ggaattgggccagagcagctgacactcgattcccttgtgaagcgggtgcgagagcacggg
gtgaccgaaattgtgatggctaccaatcccactctcgaaggagatgggacggctttgttc
atttctaatctacttgccgacgataatgtacggattacccgtcttgctcgcggcatcgcc
tctggaagcgtgttagagtttgctaacaaagagatgctggccgacgccttgcgtggccgg
caaagtttttaa

DBGET integrated database retrieval system