KEGG   Pelobacter carbinolicus: Pcar_0247Help
Entry
Pcar_0247         CDS       T00285                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pca  Pelobacter carbinolicus
Pathway
pca00020  Citrate cycle (TCA cycle)
pca00640  Propanoate metabolism
pca00660  C5-Branched dibasic acid metabolism
pca01100  Metabolic pathways
pca01110  Biosynthesis of secondary metabolites
pca01120  Microbial metabolism in diverse environments
pca01130  Biosynthesis of antibiotics
pca01200  Carbon metabolism
Module
pca_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pca_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pcar_0247 (sucC)
   00640 Propanoate metabolism
    Pcar_0247 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Pcar_0247 (sucC)
Enzymes [BR:pca01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Pcar_0247 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp Succ_CoA_lig CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: ABA87508
JGI: Pcar0247
UniProt: Q3A7Y4
Position
complement(308979..310145)
Genome map
AA seq 388 aa AA seqDB search
MKLHEYQAKQLFHRYGIPIPEGRLARSVEETGQAARAFAGRCVVKAQIHAGGRGKAGGVA
RVNSVDQARNIAQRLLQHTLVTAQTGDQGLYVGSLLVEEIVPVAREMYLSLTLDRANGRY
CLIASPDGGVDIEQTARKTPERVRRLTIDPLVGLRAFHARDIARFLGLDGPLSAAASKVI
LSLYRCLLEKDASLVEINPLAVTEEGRLMAMDAKVSIDDSALFRQKEMLEWLDESQLAPL
EVRAAHSDIAYIKMDGCIGCLVNGAGLAMATLDMLSECGGQPANFLDVGGGADQDKVVEA
FRILLEDPAVEGVLVNIFGGIMRCDLIAQGLIAAAEQVGCQLPIVVRMAGARRDEGKHLL
QQTQLNISWQDGLAAAATAIVRQLSPSA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcatgaataccaagccaagcagctcttccaccgatacggcattccgataccg
gagggcaggctggcccgttccgtagaggaaaccgggcaggccgccagggcctttgccggc
cgctgtgttgtcaaagcccagattcatgctggcggccgcggcaaggcaggcggtgtcgcc
cgggtgaattcagtggatcaggcgcgcaatattgcccagcgtttgctgcagcatactctg
gtcaccgcgcaaacgggtgatcaagggctgtatgtaggcagcctgctggtcgaggagatc
gtccccgtagcccgggaaatgtatctttccctgaccctcgaccgggccaacggccgctat
tgcctcattgcctcccccgatgggggcgtcgacattgagcagaccgcgcgcaagacaccg
gagcgcgtgcgacgtctcaccatcgaccctctggtgggactgcgcgcctttcatgcccgc
gatattgcacggttcctggggctggacgggccgctgagcgcagctgcaagcaaggtgata
ttgtccctgtatcgctgtcttctggaaaaagatgcctcgctggtggaaatcaacccgttg
gcggtaaccgaagagggccgcttgatggccatggatgccaaagtatctatcgacgacagt
gccctgttccgccagaaggaaatgcttgaatggctcgatgagagccagctggcccccttg
gaagtgcgggcggcacattcggatatcgcctacatcaagatggatggatgtatcggctgc
ctggtcaatggcgccggactggccatggcaactctcgacatgctcagcgaatgcggcgga
caaccggccaactttctcgatgtcggaggcggcgccgatcaggacaaggtggttgaagcc
ttccgcattttgcttgaggatccggctgtcgagggggttctggtgaatattttcggcggt
atcatgcgctgcgacctgatagcccaaggcctcattgcagccgccgagcaggtgggctgt
cagctacctatcgtggtgcgcatggctggagcacggcgcgatgaaggcaaacacctcctg
cagcagacccagctcaacatcagctggcaggacgggttggctgctgcggccaccgccatt
gttcggcaactttccccttccgcctga

DBGET integrated database retrieval system