KEGG   Pelobacter carbinolicus: Pcar_0254Help
Entry
Pcar_0254         CDS       T00285                                 

Gene name
aorA-1
Definition
aldehyde:ferredoxin oxidoreductase, tungsten-containing
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
pca  Pelobacter carbinolicus
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pca01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pca00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(315117..316847)
Genome map
AA seq 576 aa AA seqDB search
MNKIFRINMSNLTTKCESVPEEWAGLGGRGLTSTIVAAEVPPRCHPLGPNNKLVFAPGLL
TGTPAAQSGRLSAGAKSPLTGTIKESNAGGTAAQQLARMGIKAIIIEGAPTEDKWYRLHI
TMDGITFEAADSLVGKQNFAIIDEMIDTFGPKIGVLSIGVPGEMRMCAANISVKDPDQKI
RSHGRGGLGAVMGSKKIKCITIDDTGASKVPIADPDKFRAAAKIFAKSLLDHPVSGEGLP
TYGTNILINILNEAGGLPTKNFRYGQCEHHEKISGETMHDTIVERGGKHKHGCHAGCIIQ
CSQVYVDRAGGYITSGFEYETIWGLGANAMIEDLDDIAKCDNLMDDIGIDSIEGAVLLAT
AMEAGVIPWGDGKECQRVLRDEIGKGTPLGRILGNGTGMVGTAYGLVRVPVVKNQGIPAY
DPRSVKGIGITYATSTMGADHTAGYTIATNILKVGGYVDPLTKDGQVELSRNLQIATAAV
DSTGMCVFIAFPALDIPESFTALIDLLNATYGLDLTADDVTELGKKILKIEHDFNTAAGF
SKQDDRLPEFFSYEPIPPHNAVWDFTDEEIDEFWDF
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagatctttcgcatcaacatgtcgaacctgacaaccaagtgcgagtccgttccc
gaggaatgggcaggccttggcggtcgcggtctcacctcaaccatcgtcgccgccgaagtc
ccccccagatgccacccccttggccccaataacaaactggtcttcgctcccggcctttta
acaggcacacccgctgcacaatcgggacgcttgtcggccggcgccaaaagccctctgacc
ggaaccatcaaggaaagcaacgcgggcggcaccgccgctcaacaactggcccgcatgggt
atcaaagccatcatcatcgaaggcgcccccaccgaagacaaatggtaccgcctgcacatc
accatggacggcatcacctttgaggctgccgatagcctggtcgggaaacagaactttgcc
atcatcgacgaaatgatcgatacattcggacccaaaataggggtcctctccattggcgta
ccaggcgaaatgcgcatgtgcgccgcaaacatttccgtcaaggatccggatcagaaaatc
cgcagccacggtcgcggcggactcggagccgtcatgggatcgaaaaaaatcaagtgcatc
accattgacgacaccggggcgagcaaggtccccatcgccgacccggacaaattccgcgct
gcggcgaaaatcttcgccaaatcgctcctggaccatccggtcagcggcgaaggactgccc
acctacggcaccaatatccttatcaacatcctcaacgaagccggcggcctgccgaccaag
aacttccgctacggtcaatgcgagcaccatgaaaaaatcagcggcgagaccatgcacgac
accattgtcgagcgtggcggaaaacataagcacggttgccatgcaggctgcatcatccaa
tgctcacaggtttacgtggacagggccggcggctacatcacctcgggattcgaatacgaa
accatctggggcctgggcgccaacgccatgatcgaggatttggacgacatcgccaaatgc
gacaatttgatggacgacataggcatcgactccatcgaaggcgctgtacttctcgccacc
gccatggaagccggcgtgatcccctggggtgacggcaaggaatgccaacgcgtactgcgc
gacgagataggcaaaggcacacctctcggtcggatccttggcaacggaaccggcatggtc
ggcacagcctatggcctggtccgggtaccggtcgtcaaaaaccaggggattcccgcgtac
gatccgcggtccgtcaaaggcatcggcatcacctatgccacctccaccatgggcgccgac
cacactgccggctacaccatcgccaccaacatcctcaaggtcggcggatatgtcgatccg
ttaacgaaagacggtcaggttgaactctcgcgcaacctgcagatcgccaccgccgccgtg
gacagtaccggcatgtgtgtttttatcgccttcccggcactggatatccccgagtcgttc
actgcactgatcgacctgctcaacgcaacctacggactcgacctgacagccgacgacgta
acggagctgggcaaaaaaatcctcaaaatcgaacacgacttcaacacggctgcaggtttc
agcaagcaggatgaccgcttgccggaattcttcagctacgaaccgataccaccgcacaac
gccgtttgggacttcaccgatgaagagatcgatgagttctgggacttctga

DBGET integrated database retrieval system