KEGG   Pelobacter carbinolicus: Pcar_0345Help
Entry
Pcar_0345         CDS       T00285                                 

Gene name
acoC
Definition
(GenBank) acetoin dehydrogenase complex, E2 protein, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pca  Pelobacter carbinolicus
Pathway
pca00010  Glycolysis / Gluconeogenesis
pca00020  Citrate cycle (TCA cycle)
pca00620  Pyruvate metabolism
pca01100  Metabolic pathways
pca01110  Biosynthesis of secondary metabolites
pca01120  Microbial metabolism in diverse environments
pca01130  Biosynthesis of antibiotics
pca01200  Carbon metabolism
Module
pca_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcar_0345 (acoC)
   00020 Citrate cycle (TCA cycle)
    Pcar_0345 (acoC)
   00620 Pyruvate metabolism
    Pcar_0345 (acoC)
Enzymes [BR:pca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Pcar_0345 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 PTS_EIIA_1 RnfC_N
Motif
Other DBs
NCBI-ProteinID: ABA87605
JGI: Pcar0345
UniProt: Q3A7N9
Position
430708..432060
Genome map
AA seq 450 aa AA seqDB search
MSDNRIIALTMPKWGLTMEEGTISSWLMDEGDTIEVGSEILEVETDKIAQPVESAVEGIL
RRKIGEEDEEYPVKALIGIIAAEDVTEEEIDAFIASYGGEGAEGSDEDEAPAETAAAPEG
IYELTMPKWGLTMEEGTISSWLIDEGDEVEVGTEIMEVETDKIAQPVESTVAGVLRRKIG
EEDEEYPVKALIGIIADASVSDADIDAYLASRGGEAASGDEEEEAAAPAQPTSKPMSAMR
AAISNTVTNSWTIPQFPVTMGIEMGAAKEFRAGLKAAGKAVSMNDMVIRACGKAIEQYPM
VNATLGGKEYGLNADVNIAVAVGTDDALMMPVVKGCQALSLEEVASASRAVIDKVKAGTC
GPAEMAGGNFAISNLGMLGVDSFGALVPPGMSAILAVGGIKDEVVVKDGEMVPVSTMKVT
LVADHRVVDGLYSAQFLVELKRLLENPEEL
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaatagaatcatagctctcaccatgcccaagtggggcctgaccatggaagaa
ggcaccatctcttcctggctgatggacgagggcgacactatcgaagtcgggagtgaaatt
ctcgaagtcgaaaccgacaagatcgcgcagcccgttgaaagtgctgtcgaaggtatcctg
cgtcgcaagatcggtgaagaagacgaagaataccctgtgaaggctctgatcgggatcatc
gctgcagaggatgtcaccgaagaggaaatcgacgcgtttatcgccagctacggcggcgaa
ggtgctgagggttccgatgaagatgaagctcctgcagaaaccgctgctgcacctgaaggt
atctatgagctgaccatgcccaagtggggcctgaccatggaagaaggcaccatctcttcc
tggctcatcgacgaaggggatgaagtcgaagtcggtaccgagatcatggaagttgagacg
gataagatcgctcagccggttgaaagtaccgtggcaggtgtgttgcgtcgcaagatcggt
gaagaggacgaggaatatccggtaaaagccttgatcggtattattgccgatgcctcggta
tccgatgccgatatcgatgcttaccttgccagccgtggtggcgaagccgcctcgggtgac
gaggaagaagaagctgcagctccggcgcagccgaccagcaagccgatgtcggccatgcgt
gccgccatctccaatacggtgaccaactcgtggactattccccagttcccggtcaccatg
ggcatcgagatgggtgcggccaaggaattccgtgccggtctcaaggctgcaggcaaggct
gtttccatgaacgatatggtaatcagggcctgtggcaaggccatcgagcagtacccgatg
gttaacgccactctgggcggcaaggaatatggccttaatgccgatgtaaacatcgccgtt
gccgtcggcaccgacgatgctctgatgatgccggttgtcaagggctgtcaagccctcagc
cttgaagaagttgccagcgcttcccgcgctgtaatcgacaaggttaaggccggtacctgc
ggccctgctgaaatggctggtggtaacttcgccatttccaacctgggtatgctcggggtc
gattcattcggtgccctggtgcccccgggaatgtctgcgatcctggcagttggcggcatc
aaagacgaagtcgtagtgaaagatggcgaaatggttcccgtgtcaacgatgaaggtgacc
ctggtagccgaccaccgggtggtggacgggttgtactccgcccagttcctggtggaactg
aagcgtcttctggaaaatcccgaagagctttaa

DBGET integrated database retrieval system