KEGG   Pelobacter carbinolicus: Pcar_0488Help
Entry
Pcar_0488         CDS       T00285                                 

Gene name
cobC-3
Definition
adenosylcobalamin-5'-phosphate phosphatase
Orthology
K02226  
alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
pca  Pelobacter carbinolicus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pcar_0488 (cobC-3)
Enzymes [BR:pca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     Pcar_0488 (cobC-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(593090..593713)
Genome map
AA seq 207 aa AA seqDB search
MNGAQVYLIRHGDTGEALKGRFVGRQDVPLSSLGQRQSAALGQCSELKSCKEAFCSPMLR
VRETVGHSKLDLLCRQDEDLREIDFGRWEGLSFSEISRDFPAEVDCWARLKPDFRFPEGE
TYADFLQRIQQAAERIARTAASQSAPLAIFAHGGVIRALICQWLGLPAKHYLLFEVEPAS
VSAVRLFGDQGVLVRLNDLGHLGELPS
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcgcccaggtttatctcatccgccacggcgatacgggcgaggccctcaaaggt
cgttttgtcggtcgtcaggatgtacctctcagttcccttggtcagcggcagtccgcggca
ctgggccagtgtagtgaattaaaatcctgcaaggaagccttctgcagccccatgctgcgg
gtgcgggaaaccgtcggacattccaaactcgatttactctgtcgccaggacgaggatctg
cgtgagatcgatttcggccgatgggaaggtctttcctttagtgaaatatctcgtgatttt
cctgccgaggtcgattgctgggcacgtctgaagcctgacttccggttcccggaaggcgaa
acttacgccgacttcttacaacgcatccaacaggcggcggagcgtatcgctcgcaccgcc
gcatcgcagtccgcaccgcttgcgatctttgcccacggtggcgtcatacgggccttgatc
tgccaatggctgggtctgccggccaaacattacctgttattcgaggtcgagcccgcatcc
gtttccgcagtgcgtctgttcggcgaccagggagtactggtgcgcctcaacgacctcggt
cacctcggagagttgccgtcatga

DBGET integrated database retrieval system