KEGG   Pelobacter carbinolicus: Pcar_0512Help
Entry
Pcar_0512         CDS       T00285                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
pca  Pelobacter carbinolicus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pcar_0512
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Pcar_0512
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Pcar_0512
Enzymes [BR:pca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Pcar_0512
Exosome [BR:pca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pcar_0512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(621169..622734)
Genome map
AA seq 521 aa AA seqDB search
MYPSAVIIHCSLTPRTGKCRQEAEKISRFFHRNDLINLRVNEQPNEKTLKGLQMSSLSQK
IAAAFSILLLSVCLPGCGNSERTTNTDTAESTVTAETPTRTKNIIVMIGDGMGFNHYRAA
SLFLYGEPEGQPYTAFPLRIAMSTYPATGQYDPDTFWATFDAARQGATDSAAAATAMATG
SKTYRYAVGVDAERRKLPNIVETAEASGRATGIVTSVQFSHATPAGFGAHNPTRKNYEEI
ARDLLTKSGLEVLMGSGHPWYDDSGQLRETPNSYSFIGGESTWDALLQGDMGNDCDKDGI
IDPWTLIEEREAFRKLADGATPKRVLGIARVARTLQQKRGEAGEVSDKAFAQPFITSVPT
LAEMSRGALNVLDNDPDGFFLMIEGGAIDWASHANQTDRMIEEQVDFDRAVASVIKWVET
HSSWQDTLLIVTADHECGFLNGAGPSTQWNPLVSKGILHQPSVQWHSTGHTNALVPLFAK
GAGTQLLREEVRPRPDPVRGPYLDNTSVGNVVMTLLAPKRH
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgtacccttcagccgtgattatacactgcagcctcacgccaagaaccgggaagtgccgt
caggaagcggaaaagataagtcgatttttccatcgcaacgatttgataaacttgcgagta
aacgaacaacccaacgaaaaaacattgaaaggcttgcagatgtcttccctgtcacaaaaa
atcgccgccgccttcagcatcctgttgctgtctgtctgcctgccgggctgcggaaactcg
gaacgcaccaccaacaccgataccgccgaatccaccgttactgcggaaacacccacacgg
acaaaaaatattatcgtcatgatcggcgacggcatgggcttcaaccactatcgggccgcc
agcctgttcctgtacggtgagcctgaggggcaaccctacaccgcttttcccttgcggatt
gccatgagcacctacccggcgaccgggcagtacgatccggacaccttctgggcgaccttc
gatgcggctcgtcagggagccaccgactcggccgcagcagcgaccgccatggccaccggc
agcaagacttaccgatacgctgtgggggtggatgcggaacgtcggaaactgcccaacatc
gtcgaaacagccgaggccagcggacgcgcaaccggcattgtcaccagtgtacagttcagt
cacgccacccccgcgggctttggggcgcataatccgacccgtaaaaattacgaagagatt
gcccgggacctgcttaccaaaagcggactggaggtgctgatgggcagcggccacccttgg
tatgacgacagtggccagctccgtgaaacgccgaattcgtacagctttatcggtggagaa
tcgacttgggatgcgctgttacagggagatatgggtaacgattgcgacaaggacggtatc
atcgacccctggactctgatcgaagaacgggaagctttccgcaagctggctgacggcgcc
acgcccaaacgggttctcggtatcgcgcgagtcgcccgcactctgcagcagaagcgaggc
gaagccggcgaggtctccgacaaagcctttgcgcaaccgtttattacgtcggtaccgaca
ctggcggagatgagccgtggtgcattaaatgttctggacaacgacccggatggatttttt
ctgatgatcgaaggcggcgccatcgattgggccagtcacgccaaccagaccgacaggatg
atcgaggaacaggtcgatttcgaccgtgccgttgccagtgtcatcaagtgggtagagacg
cacagctcatggcaggacacactgctgatcgtcaccgccgaccacgaatgcggttttctc
aacggcgcaggcccctcaacacaatggaaccccctggtaagcaaaggcattctgcaccaa
ccgtccgttcaatggcattccaccggtcataccaacgcgcttgtgccgctgtttgccaaa
ggggcaggcacgcaacttttgcgggaagaagtacggccgcgccctgatccggtacgcggc
ccttatctggacaacacatcggtgggaaatgttgtcatgaccttgctggcgccaaaacgg
cattaa

DBGET integrated database retrieval system