KEGG   Pelobacter carbinolicus: Pcar_0554Help
Entry
Pcar_0554         CDS       T00285                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pca  Pelobacter carbinolicus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pcar_0554 (malQ)
Enzymes [BR:pca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Pcar_0554 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(676859..678364)
Genome map
AA seq 501 aa AA seqDB search
MTFKQRASGILLHPTSLPGPHGIGDLGNEAWRFVDFLAGAGQNIWQILPLGPAGYGHSPY
SALSAFAGNPLLISLERLIEEGDLEPEDLTGVGLDEGTVHFGFVAPFKKRLLHKGAKRFR
EGATERRKTDFDDFCRVQAAWLEDFVLFCALRSKFNDMPWQQWPPPLRSRQPDALQQVRQ
ELADALHVHRYEQFVFFEQWLALRNYANRRGVRILGDLPIFVALDSADVWAHPGLFHLDA
QLQPTVIAGVPPDYFSATGQRWGNPLYRWETHQNDDFTWWQSRLNWNLQQCDLLRIDHFR
GFVSCWAIPAGDKTAVNGQWWETPGEALFSALRHSHPHLPLVAEDLGVITPEVEHLRDRL
DLPGMKILQFAFDSGPDNPYLPHNLPKHCVIYTGTHDNDTSLGWWQTANTEIRNETAAYL
GHPITDMPWDLIHLAWASVAQLAICPLQDVLSLGGEARMNYPGRADANWSWRYLPGALTS
ELQQRLADLTRRFGRAPKRSG
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcaaacaacgcgccagcggtatcctgctgcatcccacatcccttccgggacct
cacggtatcggcgatctgggcaacgaggcctggcgattcgtcgactttcttgccggtgca
ggacaaaacatctggcagattctacctttagggccggccggctacgggcattcgccctac
agtgccttgtcggcttttgccggcaatcccctgcttatatctctggaacggctgatcgag
gaaggagatctcgagcccgaagatctgacgggcgtcggtctggatgagggaacggtgcat
tttggcttcgtcgctccctttaaaaagcgattgctgcacaaaggcgccaaacgttttcgc
gaaggggcgacggaacggcgcaaaaccgactttgatgatttttgccgtgtgcaggcggca
tggctggaagattttgtcctgttttgcgccttgcgcagcaaattcaatgacatgccatgg
caacaatggccgcctcccttgcgttcgaggcagccggatgcgctgcagcaggtccggcag
gaactggccgatgccctgcatgtccaccgctacgaacagttcgtgtttttcgagcagtgg
ctggccctacgtaactatgccaaccggcgcggcgtgcggatcctgggcgatctgccaatt
tttgtagccctcgattccgccgacgtctgggcccaccccgggctttttcatcttgatgcc
cagttgcagccgacggtgattgccggggtaccgcccgactatttcagcgccaccggccaa
cgctggggcaaccccctgtatcgctgggagacccatcagaacgatgatttcacctggtgg
cagagccgtctgaactggaacttgcaacagtgcgatctgcttcgcatcgatcatttccgc
ggctttgtctcctgctgggccatcccggccggcgacaaaaccgccgtcaacgggcaatgg
tgggagactcccggcgaggcccttttcagcgcgctgcgtcacagccatccccacctgcct
ctggtagccgaggatctgggcgtcatcacccccgaagtcgaacatctgcgcgaccgactc
gacctgcccggcatgaaaattctgcagttcgccttcgactccggccccgacaacccgtac
ctgccccacaacctgccgaagcattgcgtgatctataccggcacccacgacaacgatacc
agcctcggctggtggcagacggcaaacacggagatccgtaacgaaaccgccgcctatctc
ggccaccccattaccgacatgccatgggatctgatccacctggcctgggccagcgttgcg
cagcttgccatctgtccgttgcaggatgtgctgtccctggggggcgaggcacgcatgaac
tatcccggccgcgccgatgccaactggagctggcgttacctgccgggggcgctcacctcg
gaattacagcaacgcctggccgacctgacccgccgcttcggtcgagcccccaaaagatca
gggtaa

DBGET integrated database retrieval system