KEGG   Pelobacter carbinolicus: Pcar_0733Help
Entry
Pcar_0733         CDS       T00285                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
pca  Pelobacter carbinolicus
Pathway
pca00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pca01100  Metabolic pathways
pca01110  Biosynthesis of secondary metabolites
pca01130  Biosynthesis of antibiotics
pca01230  Biosynthesis of amino acids
Module
pca_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pcar_0733 (trpC)
Enzymes [BR:pca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Pcar_0733 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh His_biosynth IMPDH
Motif
Other DBs
NCBI-ProteinID: ABA87992
JGI: Pcar0733
UniProt: Q3A6L5
Position
871167..871967
Genome map
AA seq 266 aa AA seqDB search
MILDDILKVKKDEVRSAKRERPLVDLKARSSDAGAVRPFTQALKRRSQNGTAVIAEVKKG
SPSKGLIRPDFDPLEIARCYSRAGAACLSVLTDERFFFGRLEYLGAIREVVDLPLLRKEF
IIDPYQVYEARVFGADAVLLIAAALEDALLADLAALAAELQLDVLLEVHDEEELERALSV
PTPMLGINNRNLKTFHTDLAVTERLLPRIPADRLVVAESGIRTREDICRLQNAGAAAFLI
GESLVREQDIEGKLSTLLGRTGRGEE
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtgatactcgatgatattttgaaagtaaaaaaagatgaggttcgatctgcaaagcgagag
cggcctttagtcgatttgaaagcgcggtcgtccgatgcgggtgccgtacgtcccttcact
caggctttgaaacgtcgctctcaaaacgggacggcggttattgccgaggtgaaaaaagga
tcgccttccaaggggctgattcgccccgactttgatcctctggagattgcccggtgttac
agccgtgccggtgcggcgtgcctttcggtgttaaccgatgaacgttttttcttcggccga
ctcgaataccttggcgctatccgcgaggtggttgatctgcccctgcttcgcaaagaattt
atcatcgatccttatcaggtctatgaggcacgggtttttggcgcagatgctgttttgctg
attgcggcggccttggaggatgcgcttttagctgatctggccgccctggccgctgagctt
caactggatgtcttgctggaagtgcatgacgaggaagagttggaaagggcattgtcggtc
ccgacccctatgctcggcataaacaaccgcaatctcaaaacctttcataccgatctcgct
gtaacggaaagacttttgccgcgaatccccgcggatcgcctcgtggttgccgaaagcggc
attcgtacgcgggaagatatctgtcgccttcagaatgccggggcggccgcctttttgatc
ggcgagagtctcgtgcgcgagcaggacatcgaaggcaagttgtccacgcttttgggtcgt
acgggtaggggcgaggaatag

DBGET integrated database retrieval system