KEGG   Pelobacter carbinolicus: Pcar_0758Help
Entry
Pcar_0758         CDS       T00285                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
pca  Pelobacter carbinolicus
Brite
Enzymes [BR:pca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Pcar_0758
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(897781..898590)
Genome map
AA seq 269 aa AA seqDB search
MSRTKKKQQTVSAPRPENQAFRLRPGVSGNPGILLVHGFTASPWEMRPLGNLLYQAGYSV
AAVRLPGHGTTPEDLCRRRYEEWLAETCRTYNLLKQETGKVHSIGISTGALVLLALAAEQ
NLDSLVLLSPFLSMMHRLAPFTGILRHVRTYQSRPLPEHLTDFYYDRRPINGVYQICRLI
RHVRAALPQITTPTLAINALGDRTVKAHSGYELFLRLGSPDKEYHMFGPQTGHGLATPDH
PSWQPMLDLIQRFLTRADQDLSCPEPTAP
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgaaccaaaaaaaaacagcagacggtttctgcgccgcgcccggagaatcaggca
ttccggcttcgcccaggcgtttcgggcaatcccggcatattgcttgtgcatggcttcacg
gcatcgccatgggaaatgcgtcccctggggaaccttctttaccaggcaggctatagcgtt
gccgcagtacgtttgccgggacacggaaccacccccgaagacctttgccggcgccgctat
gaagaatggcttgcagagacctgcaggacctacaacctactgaaacaggaaaccggcaag
gtacacagcatcggcataagcaccggcgccctggttttactggccctggccgccgaacaa
aacctcgacagtctggttctgctgtcgccttttctgtccatgatgcaccgactggcgcct
ttcaccggaattttgcgtcacgtacggacctatcaatcgcgcccgttgcccgagcacctg
accgacttttattacgaccgacgcccgatcaatggcgtctaccagatctgccgattgatc
cgtcacgtgcgcgccgcgctgcctcaaatcaccacgcccacgcttgccatcaacgccctg
ggcgaccgtaccgtgaaagcccacagcggctacgaactatttcttcgtctgggaagcccc
gataaggaataccatatgttcggcccgcaaaccggccacggactggccactccggaccac
ccgtcatggcaaccgatgctcgatctcatccagcgcttcctgacgcgtgcggatcaggac
ctttcatgcccggaaccaaccgcgccataa

DBGET integrated database retrieval system