KEGG   Pelobacter carbinolicus: Pcar_0772Help
Entry
Pcar_0772         CDS       T00285                                 

Gene name
hemY
Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pca  Pelobacter carbinolicus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pcar_0772 (hemY)
Enzymes [BR:pca01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Pcar_0772 (hemY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
916168..917580
Genome map
AA seq 470 aa AA seqDB search
MNISVVGAGISGLATAFAIQQQARRLGLEWTLDIFEKEDCSGGKIRSEKVDGYLCEWGPN
GFLDSKPMTLDLCREAGLAEQLLRSNDAARKRFIFSGGRLQRVPESAADFFRSSLVSWPG
KLRLAAELLVPRRKDLTDETLADFVRRRLGREALDQMVGPMAAGIFAGDPETMSLRSCFP
RIHELEQQYGGLIRALLLLARKKRAERRAGKAVAGAAGPGGILTSFGGGIQELTDGLSRL
LAPNLHLGDAVAAITPLKEGFSLRTHKGRVHETDIVVAAVPAMALATQVEGFSAPMAAQL
RQIPYAPLQIACFGYRREALPLSLDGFGYLAARRSGMHSLGTLWSSSIFPGRAPAGYVLL
RTMFGGATRPDAAQLSADEVQQRVEEDLSRSMGIKQAPDFVRIIRHTAAIPQYVSGHGAR
LKVLEDKAAAYPGLFLVGNAFYGVGLNDCVAAADRVASRVLTLMQQRQQA
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaacatatccgttgtcggagccggtatctccggtcttgccacggcttttgccattcag
cagcaggcgcgtcggctcggtctcgaatggactctcgatattttcgagaaagaggactgc
tccggtggcaagatacgctccgaaaaggttgacggctatctctgcgaatggggtccgaac
ggttttctcgacagcaagccgatgactctggacctgtgccgcgaggccggcctggccgag
cagctgttgcgatccaacgacgcagcgcgcaaaaggtttatcttttccggggggcgtttg
caaagggtgccggaatcggctgccgacttttttcgctcctcgctggtgtcatggcccggc
aagctgcggctggcggcggagttgctggtacctcgccgcaaagacctgacggatgagacc
ttggccgatttcgtacgccgccgcctcgggcgggaggctctcgatcaaatggtcggcccc
atggcggcgggaatttttgccggggatcccgaaaccatgagtttgcgcagctgtttcccg
cgtattcacgaactggaacagcaatacggtggcctgatacgcgctctgttgctgttagca
cgaaaaaaacgcgccgaacgccgggccggtaaagcggtggccggagcggcaggacccgga
gggattcttacctccttcggcggagggattcaggagctgacagacggactctcccggctt
ctcgctccaaaccttcacctgggcgatgcggtggccgctattacgccgctgaaggaggga
ttttcccttcggacgcataaggggcgggtgcatgaaaccgatatcgtggtggctgcggtg
ccggccatggcgttggccacccaggtggaagggttttccgctccgatggcggcgcagttg
cgacagattccctacgcgccgctgcagattgcctgtttcggttaccgtcgcgaagccctg
ccgttgtcgctggacggcttcggttacctggcggcgcgccgttcgggcatgcacagcctc
ggaaccttgtggtcctcttccatttttcccggccgggccccggcggggtacgtgttgctg
cgcaccatgttcggcggcgccacccgtcccgatgctgcccagctgagtgcggatgaagta
cagcaacgcgttgaggaagatttgtcccgatccatgggcataaaacaagcgcccgatttt
gttaggattatccgccatacagcggccattccccaatatgtgtccggtcacggggcgcgc
ctgaaggttctggaggacaaggcggccgcctatccgggcctgtttttggtcggaaacgcc
ttttacggcgtcgggcttaacgattgcgtcgccgccgcagatcgtgtggcaagccgggtc
ttgacgttgatgcagcagcgccagcaggcttga

DBGET integrated database retrieval system