KEGG   Pelobacter carbinolicus: Pcar_1129Help
Entry
Pcar_1129         CDS       T00285                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pca  Pelobacter carbinolicus
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Pcar_1129
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pcar_1129
Enzymes [BR:pca01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Pcar_1129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1327098..1327643)
Genome map
AA seq 181 aa AA seqDB search
MQVTVRETPLKGCYEILPAVLGDERGSFIKTFHAPAFSRHGLCTDWREEYFSVSQQGVLR
GLHFQTPPHDHAKLVYCVGGAVLDAVVDLRRESPDYGQHATIELNPDKANMLYIPAGMAH
GFYVLRGPATMMYKVSTVYSPGHDRGILWNSAGIPWPDDNPLISPRDAAFEAFCDFESPF
S
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtaaccgtcagagaaacgccgctcaaaggctgctacgaaatcctgccggcggtc
ctgggcgatgaacgcggctcctttatcaaaacatttcatgcccccgccttttcccggcac
ggcctctgcacggattggcgggaagaatatttttccgtatcgcaacagggcgtactgcgg
ggattgcattttcaaaccccgccccatgatcacgccaagctggtctactgtgtcgggggt
gcggtgctggatgcggtcgtcgatttgcgcagggaatcgcccgactacggccaacatgcg
accattgaactgaatccggacaaggccaacatgctgtacatcccggcaggcatggcacac
gggttttatgtcctccgcggcccggcgaccatgatgtataaagtttcgacggtttacagc
cccggacacgacaggggcatcctctggaactccgccggcataccatggcccgacgacaat
ccgctcatctcccccagagacgccgcatttgaggctttttgcgattttgaatcacctttt
tcctga

DBGET integrated database retrieval system