KEGG   Pelobacter carbinolicus: Pcar_1129Help
Entry
Pcar_1129         CDS       T00285                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pca  Pelobacter carbinolicus
Pathway
pca00521  Streptomycin biosynthesis
pca00523  Polyketide sugar unit biosynthesis
pca01130  Biosynthesis of antibiotics
Module
pca_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Pcar_1129
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pcar_1129
Enzymes [BR:pca01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Pcar_1129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABA88378
JGI: Pcar1129
UniProt: Q3A5H9
Position
complement(1327098..1327643)
Genome map
AA seq 181 aa AA seqDB search
MQVTVRETPLKGCYEILPAVLGDERGSFIKTFHAPAFSRHGLCTDWREEYFSVSQQGVLR
GLHFQTPPHDHAKLVYCVGGAVLDAVVDLRRESPDYGQHATIELNPDKANMLYIPAGMAH
GFYVLRGPATMMYKVSTVYSPGHDRGILWNSAGIPWPDDNPLISPRDAAFEAFCDFESPF
S
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtaaccgtcagagaaacgccgctcaaaggctgctacgaaatcctgccggcggtc
ctgggcgatgaacgcggctcctttatcaaaacatttcatgcccccgccttttcccggcac
ggcctctgcacggattggcgggaagaatatttttccgtatcgcaacagggcgtactgcgg
ggattgcattttcaaaccccgccccatgatcacgccaagctggtctactgtgtcgggggt
gcggtgctggatgcggtcgtcgatttgcgcagggaatcgcccgactacggccaacatgcg
accattgaactgaatccggacaaggccaacatgctgtacatcccggcaggcatggcacac
gggttttatgtcctccgcggcccggcgaccatgatgtataaagtttcgacggtttacagc
cccggacacgacaggggcatcctctggaactccgccggcataccatggcccgacgacaat
ccgctcatctcccccagagacgccgcatttgaggctttttgcgattttgaatcacctttt
tcctga

DBGET integrated database retrieval system