KEGG   Pelobacter carbinolicus: Pcar_1200Help
Entry
Pcar_1200         CDS       T00285                                 

Gene name
cheB36H
Definition
protein glutamate methylesterase CheB associated with MCPs of class 36H, response receiver domain-containing
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pca  Pelobacter carbinolicus
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pca00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Pcar_1200 (cheB36H)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Pcar_1200 (cheB36H)
Enzymes [BR:pca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Pcar_1200 (cheB36H)
Two-component system [BR:pca02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Pcar_1200 (cheB36H)
Bacterial motility proteins [BR:pca02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Pcar_1200 (cheB36H)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1408854..1409915
Genome map
AA seq 353 aa AA seqDB search
MPKKIRVLVIDDSALVRQILSKGLALDPSIEVVGTAGDPYIARDKIVKLQPDVLTLDVEM
PRMDGVDFLRRLMPQYPLPVVMVSSLTQKGKQITLDSLDAGAVDFVSKPTSDIARGLKAM
LSELCAKVKLASTANVSHWKAARTVVPARLKTLEKRALAESTDKVIAIGASTGGTEAIRK
IIAQFPATMPGVVIVQHMPAGFTRLFAERLNQLCAMEVKEAATGDRIMPGRVLIGPGGFH
MKVVRSGGFYQVRCEPGPPVKGHCPSVDVMMHSVAKHVGGNAIGVMLTGMGSDGAEGMRA
MREAGARNLAQDEASCVVFGMPKVAYEMGGAHSLVSLDSMAPRIVDLLSERRI
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaaaaatacgagtgcttgttatcgatgattccgccctcgtgcggcagatcctg
agcaaggggttggccctggacccttccatcgaagtggtcggaaccgcaggggatccttat
atcgcccgggataaaattgttaaattgcaacccgatgtgctaactttggacgtcgaaatg
ccgcgtatggacggggttgacttcttacgccgcctgatgccgcaatatccacttcctgtg
gtgatggtcagttctttgacacaaaagggcaagcagatcaccctcgattctctggatgcc
ggggccgtcgatttcgtctccaagccgaccagcgatatcgcccgggggctaaaagcgatg
ctctcggaattgtgcgccaaggtcaagctggcatctaccgccaatgtctcgcattggaaa
gcggcccgaactgtggtgcctgctcggctcaaaaccctggaaaaaagggctttggccgag
tcgacggataaggttatcgccatcggtgcgtctaccggcggaaccgaagctatccgcaag
atcatagcgcagttccctgcgaccatgccgggggtggtgattgttcagcacatgccggcc
ggttttacccggctgttcgccgaacgtctcaaccagctgtgcgccatggaggtcaaggaa
gcggctaccggcgaccggatcatgccggggcgggtgttgatcggtcccggaggatttcac
atgaaagtggtgcgttccggtggcttttatcaggttcgctgcgagcccggaccgcctgtc
aaaggccattgtccttccgtcgatgtgatgatgcactctgtcgccaagcatgtagggggc
aatgccataggcgtgatgcttacgggcatgggctcggacggtgcggagggcatgagggcc
atgcgcgaagccggtgcccgcaacctggcccaggatgaagccagctgcgtggtgtttggc
atgcctaaagtggcctatgaaatggggggtgctcactccctggtatcgttggattccatg
gcacccaggattgtcgaccttctttcggagcggcgaatatga

DBGET integrated database retrieval system