KEGG   Pelobacter carbinolicus: Pcar_1216Help
Entry
Pcar_1216         CDS       T00285                                 

Definition
(GenBank) aminopeptidase, M42 family
Organism
pca  Pelobacter carbinolicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1423685..1424755
Genome map
AA seq 356 aa AA seqDB search
MDEHAVSFLQELVETPSPSGFEQPVQRIMRRELSPLADEVRTDVMGNVIARIDAASSQAM
RVMLAGHCDEIGFMVRYIDDNGFIYFAPIGGVDAHLVPGQRVHVHTADGPVLGVVGKKPI
HLMEPKDRETVVKLNSQFIDLGCADGEAARKLVAVGDPVTFAVGFERLQGELAASRGFDD
KMGAFIVVEVLRAVRQRGVPPVEVYGVSTVQEEVGLRGATTSAFGIDPQIGIAVDVGFAS
DVPGVEMKEIGEFKVGGGPIISRGANINPALFDLLLRTAEEEGIPCQIMGAPRGTGTDAN
VMQLTRAGVAAALVQVPLRYMHSPVEVLSLADIEATIRLLTGVIYRLDSDFSIIPN
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggacgaacatgcagtgagttttttgcaggaactcgtcgaaaccccgagtccttcgggt
tttgagcagcccgtgcagcgtatcatgcgtcgcgaattgtcgcctttggccgatgaggtg
cgtaccgatgtcatgggtaacgtcattgcccgtatcgatgccgcatccagtcaggccatg
cgggtgatgctggccggtcattgcgatgagatcggttttatggtgcgttatatcgacgac
aacgggtttatctatttcgctccgatcggaggcgtcgatgcgcatctggtgccgggccag
cgcgtgcacgtgcataccgctgacggcccggtgctgggggtggtaggcaaaaagcctatc
catctcatggagcctaaggaccgggaaacggtggttaaactgaacagtcagttcatcgac
ctgggctgtgccgacggagaagccgcgcgcaaactggtcgctgtgggcgatcccgttact
tttgccgtggggttcgagcgcctgcagggtgagcttgccgcttcccgtggtttcgatgac
aagatgggcgccttcatcgtggtggaagtgttgcgggccgtgcggcagcgcggtgtgccg
ccggtggaagtttacggtgtttccacagtgcaggaagaagtcggtttgcgcggtgcgacg
accagtgccttcggtatcgaccctcagatcggcattgcggtggatgtcggtttcgccagc
gatgttcccggggtggaaatgaaggaaatcggcgaattcaaagtggggggcggaccgatc
atttcccgcggtgccaacattaaccccgcgcttttcgacctgttgctacgcacggcagag
gaagagggtatcccctgtcagatcatgggcgcgccacgtggaaccggcaccgacgccaat
gtcatgcagctgacccgtgcaggcgttgcggcggcgctggtgcaggtgcccctgcgctat
atgcattcgccggtggaggttttgtcgctggccgatatcgaggccaccattcgtctgttg
acgggggtgatttaccggctggacagtgacttttccattattcctaattaa

DBGET integrated database retrieval system