KEGG   Pelobacter carbinolicus: Pcar_1239Help
Entry
Pcar_1239         CDS       T00285                                 

Definition
(GenBank) 2-oxoacid:ferredoxin oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
pca  Pelobacter carbinolicus
Pathway
pca00010  Glycolysis / Gluconeogenesis
pca00020  Citrate cycle (TCA cycle)
pca00620  Pyruvate metabolism
pca00633  Nitrotoluene degradation
pca00640  Propanoate metabolism
pca00650  Butanoate metabolism
pca00680  Methane metabolism
pca01100  Metabolic pathways
pca01120  Microbial metabolism in diverse environments
pca01130  Biosynthesis of antibiotics
pca01200  Carbon metabolism
Module
pca_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcar_1239
   00020 Citrate cycle (TCA cycle)
    Pcar_1239
   00620 Pyruvate metabolism
    Pcar_1239
   00640 Propanoate metabolism
    Pcar_1239
   00650 Butanoate metabolism
    Pcar_1239
  Energy metabolism
   00680 Methane metabolism
    Pcar_1239
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Pcar_1239
Enzymes [BR:pca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Pcar_1239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II TPP_enzyme_N Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ABA88488
JGI: Pcar1239
UniProt: Q3A569
Position
1454475..1455704
Genome map
AA seq 409 aa AA seqDB search
MRKLLTGNKAAAWGARLAEVDYLPVFPITPQTEIIETLAEWVDRGELDARLTTLESEHSM
VTAAGAAAATGVRVFTATSSQGLLYAMEMLYNVAGWRVPLVLVNVSRGLSAPITLEPDHN
DVLAARDSGFLQLHCATCQEVLDSVLLAYRLAEDKRVRLPVLVNLDGFYLSFTREPVILP
SREQVRAFLPAFDAGSNRFRGGEPVSQAVAVLGGGPYSYFRYQTHLAAVEAGEVFDELSE
AFSNHFDRGFKAIEDYRCEDAEILFVMIGSFATKAREAVDRLRDAGQKVGLLRPRLLRPF
PAREFVRLLSGRAGVAVIDQNLSTGLGGILYTELAAALYPVPRRPILASFIGGLGGRDIT
AGEFYAMAEQVRQAVETGQAPPPRLLFTDQEMQTVRGLQRIAGSEEGES
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaagctgctgaccggaaataaagccgcggcctggggggcacggctggccgaggtc
gattatctgccggtgtttcccattacaccccagaccgagatcatcgaaaccctggctgaa
tgggtcgatcgcggggaactcgatgcccggctcacgaccctcgaatcggaacattccatg
gtgaccgcggcaggggcggcggcggcgacgggggtgagggtgttcaccgccacctccagt
caggggctgctgtatgccatggaaatgctttataacgtggccggatggcgtgtgccgctg
gtgctggtcaatgtttcccggggcctgtcggcgcccatcactctggaaccggatcataac
gatgtgctggcggcgcgcgacagcggttttctgcaattacactgcgctacctgccaggag
gtactcgatagcgtgctgctcgcttatcgcctggccgaggacaaacgggtgcggctgccg
gtgctggtcaatctggacggtttttatctctcctttacccgcgaaccggtgatccttccc
tcgcgcgaacaggtgcgggcctttttgccggctttcgatgccggcagtaacagatttcgc
ggcggggagccggtcagccaggcggtggcggtgctgggcggcggtccttattcctatttc
cgttatcagactcacctggcggcggtcgaagccggggaagttttcgacgaactcagtgag
gccttcagtaatcatttcgatcgtggtttcaaggcgatcgaggattatcgctgcgaggac
gccgagatcctgttcgtcatgatcggatcctttgccaccaaggcccgcgaggccgtcgat
cgcctgcgcgatgccggtcagaaagtcggactgttgcggccgcgactgttacgtccgttt
ccagcgcgggaatttgtccgcttgctatcgggacgggcgggagtggcggttatcgatcag
aacctcagcaccgggcttggaggcattctctacaccgaactggcggcggcgctttaccct
gtgccacggcgtccgattttagcgagttttatcggcggattgggcggacgcgatatcacg
gcgggtgaattttatgccatggccgagcaggtgcgccaggccgtggaaacaggccaggct
ccgcctccgcgtttgttgtttaccgatcaggaaatgcagactgttcggggattgcagcgc
attgccggatcagaagagggggaatcatga

DBGET integrated database retrieval system