KEGG   Pelobacter carbinolicus: Pcar_1240Help
Entry
Pcar_1240         CDS       T00285                                 

Definition
2-oxoacid:ferredoxin oxidoreductase, thiamin diphosphate-binding subunit
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
pca  Pelobacter carbinolicus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:pca01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pca00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pca00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:pca00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:pca00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:pca00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:pca00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:pca00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1455701..1456612
Genome map
AA seq 303 aa AA seqDB search
MSEQDCAGTGKATRQGLLGAGTPMCAGCGGLQALHQIYDLVGDKTVFVNAAGCMTLLSIY
PFTPFPGSWLYTAMACAPAGAQGVRDALDVLLAKGRIQPEQDQLPVVLTGDGSAYGMGLS
ATSAAIDRGLDFLYICYDNEGYGNTGHQYSAATPAGARTATSRVDGYAGIKKDLFAIWSA
HRPAYVATAIGTEPADLARKLKKALSLSGPRLLLVLAPCPTGWGFEPARMVELGKLAVKT
GIWPLKEYSDGQVRHTQVPARRKPVTDYLQLQGRFRHLFAPVRDTDKLTALQRQVDDYWE
HID
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagcaggattgtgccggaaccgggaaagccactcggcagggactgttgggtgcc
ggtactcccatgtgcgcggggtgtggcgggttgcaggccttgcatcagatttacgatctg
gtgggggacaagaccgtgtttgtcaatgctgccggctgcatgaccctgctgtctatctat
ccttttacgccttttcccggctcctggctgtacacggccatggcctgcgcacccgccggt
gcccagggggtcagggatgcgctcgatgtgctgcttgccaaagggcgcattcaaccggaa
caggatcaattgccggtggtgttgaccggagacggatcggcttacggcatggggctttcc
gccacctcggcagccatcgatcgcggacttgattttctctatatctgttacgataacgaa
ggctatgggaataccggacaccagtattcggcggcaacgccggcaggagcccgcacggcc
accagccgggtcgacggttacgcggggattaaaaaggacctgttcgccatctggagcgcc
caccgaccggcctacgttgccaccgccatcggtaccgaaccggccgatctggcgcgcaag
ctaaaaaaagccttaagcttgagcggcccgcgcctgcttctggtcctggccccttgtccc
acggggtggggatttgaacccgcacgcatggtggaactcggcaagttggcagtaaagacc
ggtatctggcctctgaaggagtacagcgacgggcaggtgcggcatacccaggtcccggca
cggcggaaaccggtgacggactatttgcagttgcaggggcgtttccgacatctgtttgct
cccgtgcgggatacggataaactgaccgctctgcagcggcaggtggatgattactgggag
catatcgactaa

DBGET integrated database retrieval system