KEGG   Pelobacter carbinolicus: Pcar_1242Help
Entry
Pcar_1242         CDS       T00285                                 

Definition
medium-chain acyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pca  Pelobacter carbinolicus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pcar_1242
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcar_1242
   00620 Pyruvate metabolism
    Pcar_1242
   00640 Propanoate metabolism
    Pcar_1242
  Energy metabolism
   00680 Methane metabolism
    Pcar_1242
Enzymes [BR:pca01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Pcar_1242
Lipid biosynthesis proteins [BR:pca01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Pcar_1242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1458551..1460224)
Genome map
AA seq 557 aa AA seqDB search
MSCLLDRFVNRTEFNSYKDFKSHLNIKIPDNFNFAYDVVDVYAAEQPEKRALVWCDDHGN
DRTFTFGDLKHYSDKAANLFRSYGIKKGDHVMLILKGRYEFWFCLLGLHKIGAIATPATH
MLTSKDIKYRVEVASIPMIVSVADDGLVEHIEEGQRQTGDRIRHKLILGEPRDGWLDFKS
ELEKASADFVRPEGNENTCNDDTCLAYFSSGTTGYPKLIHHDMIYPLGHILTAKYWQNNM
DDGLHYTVADTGWAKVVWGKIYGQWLCGSAVFVYDYDKFNAASMAAMAARYGVTTFCAPP
TIYRFLIKEDLSQYDFSGLKYCVVAGEPLNPEVYERFLKYTGLKLMEAYGQTELVVTIAT
WPWMEPKPGSMGKPCPLYDIDLLNAEGRPCDVGEEGEIVINTKSGRPLGLFPGYFRDEDK
TAEVWYDGYYHTGDMAWRDEDGYYWFVGRADDVIKSSGYRIGPFEVESALMEHPAVMECA
ITGVPDPDRGQVVKATIVLTKDFTADDTLKEKLQNHVKNVTAPYKYPRIIEFVPELPKTI
SGKIRRVEIREKDDDRI
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgtcttctggaccggttcgtcaaccggaccgaatttaactcctacaaagatttc
aagtcccatctgaacatcaagattccggataatttcaacttcgcctacgatgtggtcgac
gtttatgccgccgagcagccggagaagcgcgcgctggtatggtgcgatgaccacggcaac
gaccggaccttcaccttcggcgacctgaagcactacagcgacaaagccgccaacctgttc
cgcagctacggcatcaaaaaaggcgaccatgtcatgctgatcctcaaaggtcgctacgaa
ttctggttctgcctactggggctgcacaagatcggcgccatcgccactccggccacccat
atgctcacctccaaggatatcaagtaccgcgtggaggtcgcttccatccccatgatcgtg
agtgtggccgacgacgggcttgtcgagcatatcgaggaaggccaacgtcagaccggcgac
agaatccggcacaagctgatactgggggaaccgcgggacggatggcttgatttcaagagc
gaactggaaaaggcttctgcggacttcgtgcgtccggaaggaaatgaaaacacctgcaac
gacgatacctgcctggcctatttttcctccggcaccaccggctatcccaaactgatccac
cacgacatgatctatcccctgggacatatccttaccgccaaatactggcagaacaacatg
gatgacggcctgcattacacggtggccgacacgggctgggccaaggtggtgtggggcaag
atctacggccaatggctgtgcggcagcgccgtgttcgtctatgactacgataaattcaac
gccgcatcgatggcggccatggcggcccgctacggcgtgaccaccttctgcgcaccgccg
accatctaccgtttcctcatcaaggaagatctctcccagtacgatttttccgggctgaaa
tattgcgtcgtggcgggcgagcccctgaaccctgaagtgtacgaacggttccttaaatac
accggactcaaactcatggaggcctacgggcagaccgaactggtggtcaccatcgccacc
tggccctggatggaacccaaacctggttccatgggcaaaccttgcccgctttacgatatc
gatctgctcaacgccgaagggcgcccctgcgacgtaggtgaagaaggcgaaatcgtcatc
aacaccaagtccggacggcctcttggcctgtttcccggttacttccgcgatgaagacaaa
actgccgaggtctggtacgacggttactatcacaccggtgatatggcctggcgggacgaa
gatggttattactggttcgtcggccgtgccgacgatgtcatcaaaagcagcggctaccgc
atcggaccgttcgaagtcgaaagtgctctcatggaacacccggcggttatggaatgcgcc
attaccggcgtgccggatccggaccgtggccaggtggtcaaggcgaccatcgtgctgacc
aaagattttacagccgatgatacgctaaaggaaaaactgcagaatcacgttaaaaatgtc
acagcgccttacaaatatccacgcatcatcgaattcgtgccggagttgcccaaaaccatc
agcggcaaaatccgcagggtcgaaatccgtgaaaaggacgatgacaggatttaa

DBGET integrated database retrieval system