KEGG   Pelobacter carbinolicus: Pcar_1244Help
Entry
Pcar_1244         CDS       T00285                                 

Gene name
trpB2
Definition
(GenBank) tryptophan synthase, homodimeric beta subunit
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pca  Pelobacter carbinolicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pcar_1244 (trpB2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pcar_1244 (trpB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pcar_1244 (trpB2)
Enzymes [BR:pca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pcar_1244 (trpB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1461067..1462287)
Genome map
AA seq 406 aa AA seqDB search
MSRTLNDIPLPDSKGYFGEYGGSYIPEVLQKVMDEITEAYLQIKQDKSFQEELQSLYRHY
VGRPSALFHARNLSKKIGGAQIYLKREDLNHTGAHKINHCLGEALLAKRMGKEILIAETG
AGQHGVALATAAALVGLECHIYMGEVDIAKEHPNVTRMKILGAKVIPVTRGTRTLKDAVD
AAFEAYLEDPIRQIYAIGSVVGPHPFPMMVRDFQQIVGTEARQQFLEMTGRLPDNLVACV
GGGSNAIGIFTAFLNDESVSIYGVEPSGRGLTGGDHAATLSLGKPGIMHGFRSYMLQDEN
GMPLPVYSVASGLDYPGVGPQHSLLKDLNRVNYVTAGDKDTIDAFFELSRVEGIIPALES
CHAVAYAMELAATLSAEDTILVNLSGRGDKDLDFVMENYGKDYGCE
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtaccttaaacgatattcctctgccggacagcaaaggttactttggcgaatat
ggcggcagctacatccccgaagtcctgcaaaaggtcatggatgaaatcaccgaggcctat
ctccagatcaagcaggataaatcctttcaggaagaacttcagtccctctatcgccattat
gtcggccggcccagtgccctttttcatgcgcggaacctctccaaaaaaatcggcggagcc
cagatttacctgaaacgggaagatctcaatcacaccggcgctcacaaaatcaaccattgc
ctcggcgaagccctgctggccaaacgcatgggcaaggaaatcctcatcgccgaaaccggc
gcaggccaacacggtgtcgctctggcgacggcggcggccctggtcggtctcgaatgccat
atttacatgggcgaggtggacatcgccaaagagcaccccaacgtcacccgtatgaaaatc
cttggcgccaaagttatcccggtcacgcgcggtacccggaccctcaaggatgccgtcgac
gccgcattcgaagcctaccttgaagatccgatacgccagatctacgctatcggatccgtg
gtcggcccccacccgtttccgatgatggtgcgtgattttcagcagatcgtcggcaccgaa
gcgagacaacagtttcttgaaatgaccggccgtctgccagacaacctggtggcctgcgtc
ggaggcggctctaacgccatcggcatatttaccgcgttcctcaatgatgagagcgtgtcc
atttacggtgtcgaaccctccggccgagggttgaccggcggcgatcacgcagccaccctg
tccctgggcaagccgggcatcatgcacggtttccgatcctacatgctgcaagatgaaaac
gggatgccactgcctgtctactccgtggccagcggccttgactaccccggggtcggaccc
caacatagcctgctcaaggatcttaatcgggtcaactacgtcactgcaggcgacaaagat
accatcgacgcctttttcgaattgtctcgagtggaaggtattatcccggcgctggaaagc
tgccacgccgtagcttacgccatggaacttgcagcgaccctatccgcggaagacactatt
ttggtcaatctgtccgggcgcggcgacaaggacctcgactttgtcatggaaaattacgga
aaggattacggctgcgaatag

DBGET integrated database retrieval system