KEGG   Pelobacter carbinolicus: Pcar_1244Help
Entry
Pcar_1244         CDS       T00285                                 

Gene name
trpB2
Definition
(GenBank) tryptophan synthase, homodimeric beta subunit
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pca  Pelobacter carbinolicus
Pathway
pca00260  Glycine, serine and threonine metabolism
pca00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pca01100  Metabolic pathways
pca01110  Biosynthesis of secondary metabolites
pca01130  Biosynthesis of antibiotics
pca01230  Biosynthesis of amino acids
Module
pca_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pcar_1244 (trpB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pcar_1244 (trpB2)
Enzymes [BR:pca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pcar_1244 (trpB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABA88493
JGI: Pcar1244
UniProt: Q3A564
Position
complement(1461067..1462287)
Genome map
AA seq 406 aa AA seqDB search
MSRTLNDIPLPDSKGYFGEYGGSYIPEVLQKVMDEITEAYLQIKQDKSFQEELQSLYRHY
VGRPSALFHARNLSKKIGGAQIYLKREDLNHTGAHKINHCLGEALLAKRMGKEILIAETG
AGQHGVALATAAALVGLECHIYMGEVDIAKEHPNVTRMKILGAKVIPVTRGTRTLKDAVD
AAFEAYLEDPIRQIYAIGSVVGPHPFPMMVRDFQQIVGTEARQQFLEMTGRLPDNLVACV
GGGSNAIGIFTAFLNDESVSIYGVEPSGRGLTGGDHAATLSLGKPGIMHGFRSYMLQDEN
GMPLPVYSVASGLDYPGVGPQHSLLKDLNRVNYVTAGDKDTIDAFFELSRVEGIIPALES
CHAVAYAMELAATLSAEDTILVNLSGRGDKDLDFVMENYGKDYGCE
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtaccttaaacgatattcctctgccggacagcaaaggttactttggcgaatat
ggcggcagctacatccccgaagtcctgcaaaaggtcatggatgaaatcaccgaggcctat
ctccagatcaagcaggataaatcctttcaggaagaacttcagtccctctatcgccattat
gtcggccggcccagtgccctttttcatgcgcggaacctctccaaaaaaatcggcggagcc
cagatttacctgaaacgggaagatctcaatcacaccggcgctcacaaaatcaaccattgc
ctcggcgaagccctgctggccaaacgcatgggcaaggaaatcctcatcgccgaaaccggc
gcaggccaacacggtgtcgctctggcgacggcggcggccctggtcggtctcgaatgccat
atttacatgggcgaggtggacatcgccaaagagcaccccaacgtcacccgtatgaaaatc
cttggcgccaaagttatcccggtcacgcgcggtacccggaccctcaaggatgccgtcgac
gccgcattcgaagcctaccttgaagatccgatacgccagatctacgctatcggatccgtg
gtcggcccccacccgtttccgatgatggtgcgtgattttcagcagatcgtcggcaccgaa
gcgagacaacagtttcttgaaatgaccggccgtctgccagacaacctggtggcctgcgtc
ggaggcggctctaacgccatcggcatatttaccgcgttcctcaatgatgagagcgtgtcc
atttacggtgtcgaaccctccggccgagggttgaccggcggcgatcacgcagccaccctg
tccctgggcaagccgggcatcatgcacggtttccgatcctacatgctgcaagatgaaaac
gggatgccactgcctgtctactccgtggccagcggccttgactaccccggggtcggaccc
caacatagcctgctcaaggatcttaatcgggtcaactacgtcactgcaggcgacaaagat
accatcgacgcctttttcgaattgtctcgagtggaaggtattatcccggcgctggaaagc
tgccacgccgtagcttacgccatggaacttgcagcgaccctatccgcggaagacactatt
ttggtcaatctgtccgggcgcggcgacaaggacctcgactttgtcatggaaaattacgga
aaggattacggctgcgaatag

DBGET integrated database retrieval system