KEGG   Pelobacter carbinolicus: Pcar_1318Help
Entry
Pcar_1318         CDS       T00285                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pca  Pelobacter carbinolicus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Pcar_1318
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Pcar_1318
Enzymes [BR:pca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Pcar_1318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1541271..1542419)
Genome map
AA seq 382 aa AA seqDB search
MALRLILSCIGIIVASWALPVHAATGSVHKAAARAQAKLPLGQLLMVGFAGADLDKHHPI
LEDIKQRHLGGVVLFNYGPDRNHPAGNIRSPQQLRRLTAQLQQAAGNTPLLIAIDQEGGR
INRLKQAYGFPPTVSYASLGRRNDLALTRRQAQNTARTLQQAGINLNLSPVVDLNVNPAN
PIIGRLQRSFSAEPGTVISHAREVIRAHHQQGVLCCLKHFPGHGSSTADSHKGFVDVTNT
WSPRELLPFATLIDEGLADAVLTAHVFNSELDPRYPATLSERTVHGVLRKQLGFQGVVIS
DDLTMGAIADQYRLEDAVEKALNAGVDILLLADNSPDTTSRMIAIMQKLIDSGRVTRKRI
VQALKRIDDLKSHLRSNIQRQP
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggcgctacgtctgatactatcatgcatcgggatcatagttgccagctgggccctcccc
gttcacgccgctaccggatccgtgcataaagcagccgcccgcgcccaggcgaagctgcct
ctggggcaattgctcatggtcgggtttgccggtgcggatcttgacaagcaccaccccatc
cttgaggacataaagcaacgccatctcggcggggtggtgttattcaattacggtccggac
cgcaaccatcccgcaggcaatatccgctcgccgcaacaactgcggcggcttaccgcacaa
cttcagcaagccgccggaaacacaccgctgctgattgccattgaccaggagggcggtcgc
atcaaccgcctcaaacaggcgtatggctttcctcccaccgtgtcgtatgcatcattgggg
cgacgcaatgatcttgcccttacccgccgccaggcccaaaatacggctcgaacactgcaa
caagccggcatcaatctcaacctcagtccggtcgtggatctgaacgtcaacccagccaat
cccatcatcggcaggctgcaaagaagcttttccgcagagccaggaaccgtcatatcccat
gcccgcgaagttatccgtgcccatcaccaacagggtgtcctctgctgcttgaaacacttc
cccggccatggcagttcaacagccgattcccacaaagggttcgtggacgtaacgaacacc
tggagccccagggaattattgccctttgccaccctgatcgatgaaggtctggccgatgcg
gtattgacggcgcatgtattcaacagcgaactcgaccccaggtatccggcaaccttgtcg
gaaaggaccgttcatggtgtgcttcgaaaacagctcggttttcagggggtagtcatcagt
gacgatctgaccatgggggccatcgccgatcagtaccgccttgaagatgcggtggaaaaa
gctttgaatgccggcgtcgacatcctccttttggccgacaacagcccggacaccaccagc
cgcatgattgcgatcatgcaaaaacttatcgactccggccgtgtcacccggaaacgtatc
gtgcaagccctgaaacgtatcgatgacctcaagtcccacctgcgttccaatatacagagg
cagccatga

DBGET integrated database retrieval system