KEGG   Pelobacter carbinolicus: Pcar_1318Help
Entry
Pcar_1318         CDS       T00285                                 

Definition
glycoside hydrolase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pca  Pelobacter carbinolicus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pca00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:pca00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1541271..1542419)
Genome map
AA seq 382 aa AA seqDB search
MALRLILSCIGIIVASWALPVHAATGSVHKAAARAQAKLPLGQLLMVGFAGADLDKHHPI
LEDIKQRHLGGVVLFNYGPDRNHPAGNIRSPQQLRRLTAQLQQAAGNTPLLIAIDQEGGR
INRLKQAYGFPPTVSYASLGRRNDLALTRRQAQNTARTLQQAGINLNLSPVVDLNVNPAN
PIIGRLQRSFSAEPGTVISHAREVIRAHHQQGVLCCLKHFPGHGSSTADSHKGFVDVTNT
WSPRELLPFATLIDEGLADAVLTAHVFNSELDPRYPATLSERTVHGVLRKQLGFQGVVIS
DDLTMGAIADQYRLEDAVEKALNAGVDILLLADNSPDTTSRMIAIMQKLIDSGRVTRKRI
VQALKRIDDLKSHLRSNIQRQP
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggcgctacgtctgatactatcatgcatcgggatcatagttgccagctgggccctcccc
gttcacgccgctaccggatccgtgcataaagcagccgcccgcgcccaggcgaagctgcct
ctggggcaattgctcatggtcgggtttgccggtgcggatcttgacaagcaccaccccatc
cttgaggacataaagcaacgccatctcggcggggtggtgttattcaattacggtccggac
cgcaaccatcccgcaggcaatatccgctcgccgcaacaactgcggcggcttaccgcacaa
cttcagcaagccgccggaaacacaccgctgctgattgccattgaccaggagggcggtcgc
atcaaccgcctcaaacaggcgtatggctttcctcccaccgtgtcgtatgcatcattgggg
cgacgcaatgatcttgcccttacccgccgccaggcccaaaatacggctcgaacactgcaa
caagccggcatcaatctcaacctcagtccggtcgtggatctgaacgtcaacccagccaat
cccatcatcggcaggctgcaaagaagcttttccgcagagccaggaaccgtcatatcccat
gcccgcgaagttatccgtgcccatcaccaacagggtgtcctctgctgcttgaaacacttc
cccggccatggcagttcaacagccgattcccacaaagggttcgtggacgtaacgaacacc
tggagccccagggaattattgccctttgccaccctgatcgatgaaggtctggccgatgcg
gtattgacggcgcatgtattcaacagcgaactcgaccccaggtatccggcaaccttgtcg
gaaaggaccgttcatggtgtgcttcgaaaacagctcggttttcagggggtagtcatcagt
gacgatctgaccatgggggccatcgccgatcagtaccgccttgaagatgcggtggaaaaa
gctttgaatgccggcgtcgacatcctccttttggccgacaacagcccggacaccaccagc
cgcatgattgcgatcatgcaaaaacttatcgactccggccgtgtcacccggaaacgtatc
gtgcaagccctgaaacgtatcgatgacctcaagtcccacctgcgttccaatatacagagg
cagccatga

DBGET integrated database retrieval system