KEGG   Pelobacter carbinolicus: Pcar_1333Help
Entry
Pcar_1333         CDS       T00285                                 

Gene name
tpi
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pca  Pelobacter carbinolicus
Pathway
pca00010  Glycolysis / Gluconeogenesis
pca00051  Fructose and mannose metabolism
pca00562  Inositol phosphate metabolism
pca01100  Metabolic pathways
pca01110  Biosynthesis of secondary metabolites
pca01120  Microbial metabolism in diverse environments
pca01130  Biosynthesis of antibiotics
pca01200  Carbon metabolism
pca01230  Biosynthesis of amino acids
Module
pca_M00002  Glycolysis, core module involving three-carbon compounds
pca_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcar_1333 (tpi)
   00051 Fructose and mannose metabolism
    Pcar_1333 (tpi)
   00562 Inositol phosphate metabolism
    Pcar_1333 (tpi)
Enzymes [BR:pca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Pcar_1333 (tpi)
Exosome [BR:pca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Pcar_1333 (tpi)
  Exosomal proteins of bladder cancer cells
   Pcar_1333 (tpi)
  Exosomal proteins of melanoma cells
   Pcar_1333 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABA88582
JGI: Pcar1333
UniProt: Q3A4X5
Position
1558226..1558984
Genome map
AA seq 252 aa AA seqDB search
MRRPFIAGNWKLHKTSAEAAALVGELKGALSDVVDRDIVVAPVFTSLAAVIATLEKSDIS
VAAQNCYPENQGAFTGEVSPALLKDAGCRYVIVGHSERRQLFAESDAFINRKVKAVIDAG
LSAILCIGETLEEREADKTFDVLERQVRCGLEGLDAAAMEQIVVAYEPVWAIGTGKTATD
SQAQQAHSFIRSLVNDIFGSKVAQQVRIVYGGSVKPGNVDGLLQQPDIDGALVGGASLNA
EDFIRIVKFKAV
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagaccctttattgccggaaactggaaactgcataaaacatcggcggaggccgcg
gccctggtgggagagctgaaaggcgcgctgtccgatgtggttgaccgcgacattgtcgtg
gctcccgtattcacctcgttggctgcggtcatcgccacgctcgagaaaagcgacatttct
gtggctgcccagaattgttaccctgaaaatcagggggcctttacgggcgaagtgtcgcca
gccttgctgaaagacgccggttgtcgctatgttatcgtcgggcattccgagcgccgccag
cttttcgccgaatccgatgcttttatcaaccgcaaagtcaaggctgttatcgatgccggg
ctgtcggctattttatgtatcggtgaaacgctggaggagcgggaggcggacaagaccttt
gatgttcttgagcgccaggtgcggtgcggcctggaggggctggatgcggctgccatggaa
cagattgtggtggcctatgagcctgtatgggctatcggtaccggcaaaaccgccaccgac
agtcaggctcagcaggcgcacagctttattcgcagccttgttaacgatatcttcggttcc
aaagtggctcaacaggtcagaatcgtctatggaggtagcgttaaacccggcaatgtcgat
ggtctgctgcaacaacccgatatcgatggtgcgctggttggcggcgccagccttaacgcc
gaagattttatccgtatcgtgaagttcaaagcggtttaa

DBGET integrated database retrieval system