KEGG   Pelobacter carbinolicus: Pcar_1333Help
Entry
Pcar_1333         CDS       T00285                                 

Gene name
tpi
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pca  Pelobacter carbinolicus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pcar_1333 (tpi)
   01230 Biosynthesis of amino acids
    Pcar_1333 (tpi)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcar_1333 (tpi)
   00051 Fructose and mannose metabolism
    Pcar_1333 (tpi)
   00562 Inositol phosphate metabolism
    Pcar_1333 (tpi)
Enzymes [BR:pca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Pcar_1333 (tpi)
Exosome [BR:pca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Pcar_1333 (tpi)
  Exosomal proteins of bladder cancer cells
   Pcar_1333 (tpi)
  Exosomal proteins of melanoma cells
   Pcar_1333 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1558226..1558984
Genome map
AA seq 252 aa AA seqDB search
MRRPFIAGNWKLHKTSAEAAALVGELKGALSDVVDRDIVVAPVFTSLAAVIATLEKSDIS
VAAQNCYPENQGAFTGEVSPALLKDAGCRYVIVGHSERRQLFAESDAFINRKVKAVIDAG
LSAILCIGETLEEREADKTFDVLERQVRCGLEGLDAAAMEQIVVAYEPVWAIGTGKTATD
SQAQQAHSFIRSLVNDIFGSKVAQQVRIVYGGSVKPGNVDGLLQQPDIDGALVGGASLNA
EDFIRIVKFKAV
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgcagaccctttattgccggaaactggaaactgcataaaacatcggcggaggccgcg
gccctggtgggagagctgaaaggcgcgctgtccgatgtggttgaccgcgacattgtcgtg
gctcccgtattcacctcgttggctgcggtcatcgccacgctcgagaaaagcgacatttct
gtggctgcccagaattgttaccctgaaaatcagggggcctttacgggcgaagtgtcgcca
gccttgctgaaagacgccggttgtcgctatgttatcgtcgggcattccgagcgccgccag
cttttcgccgaatccgatgcttttatcaaccgcaaagtcaaggctgttatcgatgccggg
ctgtcggctattttatgtatcggtgaaacgctggaggagcgggaggcggacaagaccttt
gatgttcttgagcgccaggtgcggtgcggcctggaggggctggatgcggctgccatggaa
cagattgtggtggcctatgagcctgtatgggctatcggtaccggcaaaaccgccaccgac
agtcaggctcagcaggcgcacagctttattcgcagccttgttaacgatatcttcggttcc
aaagtggctcaacaggtcagaatcgtctatggaggtagcgttaaacccggcaatgtcgat
ggtctgctgcaacaacccgatatcgatggtgcgctggttggcggcgccagccttaacgcc
gaagattttatccgtatcgtgaagttcaaagcggtttaa

DBGET integrated database retrieval system