KEGG   Pelobacter carbinolicus: Pcar_1427Help
Entry
Pcar_1427         CDS       T00285                                 

Gene name
pcm
Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pca  Pelobacter carbinolicus
Brite
Enzymes [BR:pca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Pcar_1427 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_23 Methyltransf_11 RrnaAD Methyltransf_31 Fibrillarin
Motif
Other DBs
NCBI-ProteinID: ABA88673
JGI: Pcar1427
UniProt: Q3A4N4
Position
1674926..1675579
Genome map
AA seq 217 aa AA seqDB search
MDYSIARRLMVEQQVIRRGVSDPLVVDAMMRVPRHLFVEEALWSQAYSDFPLPIGEKQTI
SQPFMVAFMTESLCLHGGEKVLEIGTGSGYQAAVLSQIVSRVYTVERLPGLARRARRILD
SVGCRNVNIKLTDGTFGWEEESPFDGIVVTAGSPQIPHHYLEQLAVGGRLVIPVGNRGSQ
VLKRVVRTGVEKFSEEDLLDCRFVPLVGKYGWHEEGD
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggattattcgatagcccggcgattaatggttgaacagcaggttattcgccgaggagtg
agcgatcccctggttgttgatgccatgatgcgggttccgcgtcacttgtttgtcgaagag
gctttgtggtcgcaggcctacagtgattttcctttgcccatcggcgaaaaacagaccatt
tctcaaccctttatggttgcgtttatgactgaatccctgtgcttgcacggtggtgaaaaa
gttcttgaaataggtacgggttcgggttatcaggctgcagtgttgagtcagatcgtctcc
cgtgtttatacggtggagcgtttacccggtctggcgcgacgggctcgcaggatactcgat
tcggttgggtgccggaacgtcaatatcaaacttaccgacggcaccttcggatgggaagaa
gaatcgccctttgacggtattgttgttactgccggcagtccgcagatcccacatcactat
ctggagcagttggctgttggcgggcgtcttgtgattcctgtcggaaatcggggcagccag
gttctcaagcgggtagtgcgaaccggggtcgaaaaattttccgaggaagatctgctggat
tgccgttttgtccccttggtagggaagtatggctggcacgaagagggggattga

DBGET integrated database retrieval system