KEGG   Pelobacter carbinolicus: Pcar_1427Help
Entry
Pcar_1427         CDS       T00285                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
pca  Pelobacter carbinolicus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1674926..1675579
Genome map
AA seq 217 aa AA seqDB search
MDYSIARRLMVEQQVIRRGVSDPLVVDAMMRVPRHLFVEEALWSQAYSDFPLPIGEKQTI
SQPFMVAFMTESLCLHGGEKVLEIGTGSGYQAAVLSQIVSRVYTVERLPGLARRARRILD
SVGCRNVNIKLTDGTFGWEEESPFDGIVVTAGSPQIPHHYLEQLAVGGRLVIPVGNRGSQ
VLKRVVRTGVEKFSEEDLLDCRFVPLVGKYGWHEEGD
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggattattcgatagcccggcgattaatggttgaacagcaggttattcgccgaggagtg
agcgatcccctggttgttgatgccatgatgcgggttccgcgtcacttgtttgtcgaagag
gctttgtggtcgcaggcctacagtgattttcctttgcccatcggcgaaaaacagaccatt
tctcaaccctttatggttgcgtttatgactgaatccctgtgcttgcacggtggtgaaaaa
gttcttgaaataggtacgggttcgggttatcaggctgcagtgttgagtcagatcgtctcc
cgtgtttatacggtggagcgtttacccggtctggcgcgacgggctcgcaggatactcgat
tcggttgggtgccggaacgtcaatatcaaacttaccgacggcaccttcggatgggaagaa
gaatcgccctttgacggtattgttgttactgccggcagtccgcagatcccacatcactat
ctggagcagttggctgttggcgggcgtcttgtgattcctgtcggaaatcggggcagccag
gttctcaagcgggtagtgcgaaccggggtcgaaaaattttccgaggaagatctgctggat
tgccgttttgtccccttggtagggaagtatggctggcacgaagagggggattga

DBGET integrated database retrieval system