KEGG   Pelobacter carbinolicus: Pcar_1502Help
Entry
Pcar_1502         CDS       T00285                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pca  Pelobacter carbinolicus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pcar_1502 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pcar_1502 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Pcar_1502 (thrC)
Enzymes [BR:pca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Pcar_1502 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1756963..1758354)
Genome map
AA seq 463 aa AA seqDB search
MQYMSTRGTTSGINFKDAVMMGLADDGGLLLPESIPSLSPGDIAALTKMAYPDLAFRIIS
MFAGNIPAADLKQLIDKSYQTFSHSEVAPVVHKDGIYILELFHGPTRAFKDIALQFLGNM
FEYLLKQSGAHMNILGATSGDTGSAAIYGVRGKENINIFIMHPHQRVSPIQELQMTTVTD
PNVFNLAIRGTFDDGQRIVKEIFGDLDFKGSMSLGAVNSINWARVLAQVVYYFYAFGRVQ
RATNCQEVYFSVPTGNFGDIFAGYIAKRMGLPIRRLILATNENDILTRFINQGDYSTAQV
VPTPSPSMDIQLASNFERYLFYLFNQDHAKVRNAMAELAANGRLKFEAEDMTRVANDFLA
GSATRQETLDTIQAFHKATGYTLDPHTAVGVKVGKELTGGEVPLICLSTAHPAKFGEAVK
QAIGEDPEMPPEFKGIETRERRCEILDADTETIKDYISRKALR
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgcaatacatgagcacccgcggtacgaccagcggcattaactttaaagacgcagtcatg
atgggcctggcggatgacggcggcctgctgctaccggaatcgatccccagtctttccccc
ggagacatcgccgccctgactaaaatggcctatcccgacctggcctttcgcattatctcc
atgtttgccgggaacattcccgcagcagacctgaagcagcttattgataaatcctaccag
accttcagccattcggaagttgcaccggtcgttcataaagacggaatctacatcctcgaa
ctgttccacggcccaacccgggctttcaaagacattgccctgcagtttctgggcaacatg
ttcgagtacctgctcaaacaaagcggtgcgcacatgaatatcctcggcgccacctcgggc
gacacaggaagtgctgcgatttacggtgttcgaggcaaagaaaatatcaatattttcatt
atgcacccccaccagcgagtgtcccccattcaggaactccaaatgaccacggttaccgac
cccaatgtcttcaacctggccatccgcggaaccttcgatgacgggcaacgcatcgtgaag
gaaatttttggcgatctggacttcaagggaagcatgtccctgggcgccgtcaactccatc
aactgggcaagggtccttgcgcaagtcgtatactatttttacgccttcggccgggtccag
cgcgccaccaactgccaggaggtctacttctccgtgccaacggggaacttcggcgacatc
tttgccggctatatcgccaaacgcatggggctgcccatccgtcgcctgattctggctacc
aacgaaaacgacatcctcacccgcttcatcaatcagggcgattactcgaccgcacaggtt
gtgccgaccccatcaccatccatggacatccagttggccagcaattttgaacgttacctg
ttctacctgttcaaccaggaccacgcaaaagtacgcaatgccatggcagaactggccgcc
aatggccgcctgaagttcgaagctgaagacatgacgcgcgtagccaatgactttttggca
ggatcggcgacacgccaggaaaccctggacaccattcaagcgttccataaagccaccggc
tacaccctggatcctcatacggcggttggcgttaaggtaggtaaagagctcaccggtggc
gaggtacccctgatttgtctttcaacagcccatccggcgaagttcggagaagccgtcaag
caggccataggagaagatcctgaaatgcctccggagttcaaagggatcgaaaccagggag
cggcgctgtgaaattctcgacgcagacacagaaaccatcaaagattacatcagccgaaag
gccttacgataa

DBGET integrated database retrieval system