KEGG   Pelobacter carbinolicus: Pcar_1507Help
Entry
Pcar_1507         CDS       T00285                                 

Definition
(GenBank) ROK domain transcriptional regulator/sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pca  Pelobacter carbinolicus
Pathway
pca00010  Glycolysis / Gluconeogenesis
pca00052  Galactose metabolism
pca00500  Starch and sucrose metabolism
pca00520  Amino sugar and nucleotide sugar metabolism
pca00521  Streptomycin biosynthesis
pca01100  Metabolic pathways
pca01110  Biosynthesis of secondary metabolites
pca01120  Microbial metabolism in diverse environments
pca01130  Biosynthesis of antibiotics
pca01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcar_1507
   00052 Galactose metabolism
    Pcar_1507
   00500 Starch and sucrose metabolism
    Pcar_1507
   00520 Amino sugar and nucleotide sugar metabolism
    Pcar_1507
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pcar_1507
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Pcar_1507
Enzymes [BR:pca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Pcar_1507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ABA88753
JGI: Pcar1507
UniProt: Q3A4F4
Position
1760865..1761824
Genome map
AA seq 319 aa AA seqDB search
MNPSVVIGIDLGGTNCRGALVTGSGELLCLQNFATDIDSGFDCFWRRFLGFCRSMMADAQ
AQGFLIEGLGLGFPGLVAADGSITVAPNLPPFNGLALRERLCHELGMSVRVANDVNAIAL
GEAHWGAGRDCSDFLMVTLGTGVGGGLIVRRQLWSGCDGAAGEVGHIVVEPDGYLCGCGS
RGCLEQYASGPAVVRNYQAMVRRGTSKIHVPAVQPKTAEEVAVAALNGDAAAMGAFEVAG
RYLGQVLAGVANLLNLEAAVIGGGVGASFDLFLPSLRAELEHRAFAVAARRMQIKPALLG
DKAGILGAASLVREMLRAK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaacccatcggttgtgatcggcattgatcttggaggcaccaattgccgcggggcgttg
gtgaccggttccggggaattgctttgtctgcaaaactttgccacggatatcgactcgggc
tttgactgtttttggcgtcggtttctggggttttgtcgctccatgatggctgatgctcag
gcgcaaggtttcctgatcgagggactgggtctgggtttccccggcctggttgcagctgat
ggatccattaccgtggcgccgaatctgcccccttttaacggattggcgttgagagaacgt
ctttgccatgaactcggaatgtcggttcgggttgccaacgatgtcaatgccattgccctg
ggggaggctcattggggcgccggacgggattgttccgatttccttatggtgactctcggg
acgggcgtcggcggaggtctgatcgtgcggcggcaactgtggagtggttgcgacggtgcg
gccggcgaagttggtcatattgttgttgagcctgacgggtatctttgtggctgcggttcc
cgaggttgccttgagcaatacgcttccgggccggcggtggtcaggaattatcaggctatg
gtccgtcgtggaacctcaaagatccatgtgcctgccgttcagcctaagacggccgaggag
gttgctgtggccgctttgaatggagatgctgctgcgatgggcgcttttgaggtcgctggt
cgttatcttggtcaggtgcttgccggcgttgccaaccttctcaatctggaggctgccgtg
atagggggaggggtcggtgccagttttgatctttttcttccttctttgcgtgccgagttg
gagcatagggcctttgccgtggcagctcgccgcatgcagataaagccagcgcttttgggt
gataaggccggtattctcggtgcggccagcctggttcgagaaatgctccgggcaaagtga

DBGET integrated database retrieval system