KEGG   Pelobacter carbinolicus: Pcar_1507Help
Entry
Pcar_1507         CDS       T00285                                 

Definition
ROK domain transcriptional regulator/sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pca  Pelobacter carbinolicus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pcar_1507
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcar_1507
   00052 Galactose metabolism
    Pcar_1507
   00500 Starch and sucrose metabolism
    Pcar_1507
   00520 Amino sugar and nucleotide sugar metabolism
    Pcar_1507
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pcar_1507
   00524 Butirosin and neomycin biosynthesis
    Pcar_1507
Enzymes [BR:pca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Pcar_1507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1760865..1761824
Genome map
AA seq 319 aa AA seqDB search
MNPSVVIGIDLGGTNCRGALVTGSGELLCLQNFATDIDSGFDCFWRRFLGFCRSMMADAQ
AQGFLIEGLGLGFPGLVAADGSITVAPNLPPFNGLALRERLCHELGMSVRVANDVNAIAL
GEAHWGAGRDCSDFLMVTLGTGVGGGLIVRRQLWSGCDGAAGEVGHIVVEPDGYLCGCGS
RGCLEQYASGPAVVRNYQAMVRRGTSKIHVPAVQPKTAEEVAVAALNGDAAAMGAFEVAG
RYLGQVLAGVANLLNLEAAVIGGGVGASFDLFLPSLRAELEHRAFAVAARRMQIKPALLG
DKAGILGAASLVREMLRAK
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaacccatcggttgtgatcggcattgatcttggaggcaccaattgccgcggggcgttg
gtgaccggttccggggaattgctttgtctgcaaaactttgccacggatatcgactcgggc
tttgactgtttttggcgtcggtttctggggttttgtcgctccatgatggctgatgctcag
gcgcaaggtttcctgatcgagggactgggtctgggtttccccggcctggttgcagctgat
ggatccattaccgtggcgccgaatctgcccccttttaacggattggcgttgagagaacgt
ctttgccatgaactcggaatgtcggttcgggttgccaacgatgtcaatgccattgccctg
ggggaggctcattggggcgccggacgggattgttccgatttccttatggtgactctcggg
acgggcgtcggcggaggtctgatcgtgcggcggcaactgtggagtggttgcgacggtgcg
gccggcgaagttggtcatattgttgttgagcctgacgggtatctttgtggctgcggttcc
cgaggttgccttgagcaatacgcttccgggccggcggtggtcaggaattatcaggctatg
gtccgtcgtggaacctcaaagatccatgtgcctgccgttcagcctaagacggccgaggag
gttgctgtggccgctttgaatggagatgctgctgcgatgggcgcttttgaggtcgctggt
cgttatcttggtcaggtgcttgccggcgttgccaaccttctcaatctggaggctgccgtg
atagggggaggggtcggtgccagttttgatctttttcttccttctttgcgtgccgagttg
gagcatagggcctttgccgtggcagctcgccgcatgcagataaagccagcgcttttgggt
gataaggccggtattctcggtgcggccagcctggttcgagaaatgctccgggcaaagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system