KEGG   Pelobacter carbinolicus: Pcar_1508Help
Entry
Pcar_1508         CDS       T00285                                 

Gene name
pfk-1
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
pca  Pelobacter carbinolicus
Pathway
pca00010  Glycolysis / Gluconeogenesis
pca00030  Pentose phosphate pathway
pca00051  Fructose and mannose metabolism
pca00052  Galactose metabolism
pca00680  Methane metabolism
pca01100  Metabolic pathways
pca01110  Biosynthesis of secondary metabolites
pca01120  Microbial metabolism in diverse environments
pca01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcar_1508 (pfk-1)
   00030 Pentose phosphate pathway
    Pcar_1508 (pfk-1)
   00051 Fructose and mannose metabolism
    Pcar_1508 (pfk-1)
   00052 Galactose metabolism
    Pcar_1508 (pfk-1)
  Energy metabolism
   00680 Methane metabolism
    Pcar_1508 (pfk-1)
Enzymes [BR:pca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Pcar_1508 (pfk-1)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Pcar_1508 (pfk-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ABA88754
JGI: Pcar1508
UniProt: Q3A4F3
Position
1761903..1762994
Genome map
AA seq 363 aa AA seqDB search
MSRCIALLNGGGDCPGLNGVIRGVVRAAVLQRGWRVLGVEDGFDGLVEGPRCRELDLKSV
CGILPRGGTILGTSNRGNPFRYPVANENGDVILKDVSRQVVDHFQKLGADALVAVGGDGT
LKIARRLSDLGIPVVGVPKTIDNDLQETDVTFGYNTAVGIVTEALDRLQTTAESHHRVMV
VEVMGRDAGWIALEAGIAGSAEVILLPEIPFDLDLVCDHIMDRRARGSRFSIIVVAEGAF
PKGGRKIVQASADQTHGLERLGGIGHYVAAEIGRRKGLETRVVVLGHVQRGGTPSPFDRI
LASRFGVRAVQLIEREEYGHMVALRGRDVVSVPIEQAVDGQNLVDPDANLVWTAEQLGIM
LGR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgatgtattgccctattgaacggtggcggtgattgtcccggattgaacggtgtg
attcgcggtgtggtgagggctgccgttttacagcggggctggcgtgtgctgggggttgaa
gacggtttcgacggtcttgttgaagggccgcgatgccgggaacttgatctcaaatcggtg
tgcggcatactcccgcgcggcgggaccattttgggtaccagcaatcgaggaaaccccttt
cgttatccggtggccaacgaaaatggcgacgttattctcaaggatgtgtccagacaggtc
gtggaccattttcagaagcttggagcggatgcgctggtggccgtgggcggtgatgggacg
ctcaagatcgcccggcgcttgagcgatctcgggataccggtcgtcggtgtgcccaagacg
atcgataacgatttgcaggagacggacgttactttcggctacaataccgcggtcggcatc
gtcaccgaagctctcgatcgtttgcagacgactgccgaaagtcatcatcgcgtcatggtg
gtcgaggtgatgggaagggatgcaggctggatcgccctggaagcaggcattgccggttcc
gcagaggtgatcttgttgcctgaaataccctttgacctggatctggtatgtgaccacatc
atggacaggcgcgcgcgaggcagtcggttttcgattatcgttgtggccgagggggctttt
cccaaagggggacgtaaaatcgtccaggcttcggccgatcagactcatggtcttgagcgc
ctcggcggcatcggtcattatgtagccgctgaaatcgggcgccgcaaaggattggaaacc
cgtgtcgtggtgctgggacatgtccagcgcggcggaacaccgtcgccttttgatcgtatc
ctggccagccgttttggggtgcgcgcggtgcagcttatcgaacgggaagagtacgggcac
atggtcgccctgcgtggccgggatgttgtgtcggtgcccatcgaacaggctgttgatgga
caaaatctggtcgatccggatgcgaatctggtgtggacggcagagcaactgggtatcatg
ctgggacgctga

DBGET integrated database retrieval system