KEGG   Pelobacter carbinolicus: Pcar_1508Help
Entry
Pcar_1508         CDS       T00285                                 

Gene name
pfk-1
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pca  Pelobacter carbinolicus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pcar_1508 (pfk-1)
   01230 Biosynthesis of amino acids
    Pcar_1508 (pfk-1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcar_1508 (pfk-1)
   00030 Pentose phosphate pathway
    Pcar_1508 (pfk-1)
   00051 Fructose and mannose metabolism
    Pcar_1508 (pfk-1)
   00052 Galactose metabolism
    Pcar_1508 (pfk-1)
  Energy metabolism
   00680 Methane metabolism
    Pcar_1508 (pfk-1)
Enzymes [BR:pca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Pcar_1508 (pfk-1)
Protein phosphatases and associated proteins [BR:pca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Pcar_1508 (pfk-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1761903..1762994
Genome map
AA seq 363 aa AA seqDB search
MSRCIALLNGGGDCPGLNGVIRGVVRAAVLQRGWRVLGVEDGFDGLVEGPRCRELDLKSV
CGILPRGGTILGTSNRGNPFRYPVANENGDVILKDVSRQVVDHFQKLGADALVAVGGDGT
LKIARRLSDLGIPVVGVPKTIDNDLQETDVTFGYNTAVGIVTEALDRLQTTAESHHRVMV
VEVMGRDAGWIALEAGIAGSAEVILLPEIPFDLDLVCDHIMDRRARGSRFSIIVVAEGAF
PKGGRKIVQASADQTHGLERLGGIGHYVAAEIGRRKGLETRVVVLGHVQRGGTPSPFDRI
LASRFGVRAVQLIEREEYGHMVALRGRDVVSVPIEQAVDGQNLVDPDANLVWTAEQLGIM
LGR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgatgtattgccctattgaacggtggcggtgattgtcccggattgaacggtgtg
attcgcggtgtggtgagggctgccgttttacagcggggctggcgtgtgctgggggttgaa
gacggtttcgacggtcttgttgaagggccgcgatgccgggaacttgatctcaaatcggtg
tgcggcatactcccgcgcggcgggaccattttgggtaccagcaatcgaggaaaccccttt
cgttatccggtggccaacgaaaatggcgacgttattctcaaggatgtgtccagacaggtc
gtggaccattttcagaagcttggagcggatgcgctggtggccgtgggcggtgatgggacg
ctcaagatcgcccggcgcttgagcgatctcgggataccggtcgtcggtgtgcccaagacg
atcgataacgatttgcaggagacggacgttactttcggctacaataccgcggtcggcatc
gtcaccgaagctctcgatcgtttgcagacgactgccgaaagtcatcatcgcgtcatggtg
gtcgaggtgatgggaagggatgcaggctggatcgccctggaagcaggcattgccggttcc
gcagaggtgatcttgttgcctgaaataccctttgacctggatctggtatgtgaccacatc
atggacaggcgcgcgcgaggcagtcggttttcgattatcgttgtggccgagggggctttt
cccaaagggggacgtaaaatcgtccaggcttcggccgatcagactcatggtcttgagcgc
ctcggcggcatcggtcattatgtagccgctgaaatcgggcgccgcaaaggattggaaacc
cgtgtcgtggtgctgggacatgtccagcgcggcggaacaccgtcgccttttgatcgtatc
ctggccagccgttttggggtgcgcgcggtgcagcttatcgaacgggaagagtacgggcac
atggtcgccctgcgtggccgggatgttgtgtcggtgcccatcgaacaggctgttgatgga
caaaatctggtcgatccggatgcgaatctggtgtggacggcagagcaactgggtatcatg
ctgggacgctga

DBGET integrated database retrieval system