KEGG   Pelobacter carbinolicus: Pcar_1542Help
Entry
Pcar_1542         CDS       T00285                                 

Gene name
pfk-3
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pca  Pelobacter carbinolicus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pcar_1542 (pfk-3)
   01230 Biosynthesis of amino acids
    Pcar_1542 (pfk-3)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcar_1542 (pfk-3)
   00030 Pentose phosphate pathway
    Pcar_1542 (pfk-3)
   00051 Fructose and mannose metabolism
    Pcar_1542 (pfk-3)
   00052 Galactose metabolism
    Pcar_1542 (pfk-3)
  Energy metabolism
   00680 Methane metabolism
    Pcar_1542 (pfk-3)
Enzymes [BR:pca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Pcar_1542 (pfk-3)
Protein phosphatases and associated proteins [BR:pca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Pcar_1542 (pfk-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1809076..1810272)
Genome map
AA seq 398 aa AA seqDB search
MSYRGTIGILTGGGDVPGLNPAIRAVTFRALREGYRVVGIRRGWGGLVDYQLDNQIDNSA
HVQILTEDLVNRAGRTGGTFLHTSRTLPARLPRSAVPQHLRARYDDDINDVTPHVLDAIE
AIGIDYLIPIGGDDTLSYAERLHREGIRIVGIPKTMDNDVPGTDYCIGFSTCVTRTIELT
HTLRTTAGSHERLLVIEVFGRYAGFTAMLPTMAGAADRCVIPEQPFDMRHLTRLLVEDRN
HHPSGYAVVLVSEGATMVDEAGMSFEGQEKDQYGHRKLGGIGDKVAAQLKELSPEFNKGK
RINVVNQRLGYLVRCGNPDAIDSIVPMAYGNLALDLILKNRSGQLIALRNGCYANVPIDI
VSSRKKIVTVDKYYNAERLRPKYETFRDQPMFIMTSEM
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagctatcgcggcaccatcggcatccttaccggcgggggagatgtcccgggattgaat
ccggccatccgcgcagttacgttccgcgcattacgtgaaggctaccgggttgtcggtatt
cgtcggggctggggcggactggtagactatcaactcgacaatcagatcgacaacagcgct
cacgtacagattctcaccgaagatttggtcaatcgtgccggccgtacgggtggcacattt
ttacacacgtcccgcacccttcccgcccgcctgccccgttctgccgtaccccagcatctg
cgcgcccgatacgatgacgacatcaatgacgtaacaccgcatgttttggatgccatagaa
gccattggcatcgattaccttattcccatcggtggcgacgacaccctgagctacgcagaa
cgactccatcgcgaaggcattcgcatcgtgggcatcccgaaaaccatggataacgatgtt
cccggcaccgactattgcatcggtttcagcacctgcgtgacccgcaccatcgaactcact
cataccctgcgtaccaccgccggttcccacgaacgattactggtgatcgaagtgttcggc
cggtacgcgggctttaccgccatgctgccgaccatggccggcgcagctgaccgttgtgtc
atccccgaacagcccttcgacatgaggcatttgacgcgattgctggtagaggatcgcaac
caccacccaagcggctatgcggtggtgctggtatcggaaggtgctacgatggttgatgaa
gcgggaatgtcctttgaagggcaggaaaaagatcagtatggccaccgcaagttggggggg
atcggcgacaaggtcgccgcgcagctcaaagaactctcccccgaattcaacaaggggaag
cgcatcaacgtggtcaaccagcgcctgggataccttgttcgctgcggcaacccggacgcc
atcgattccatcgtccccatggcctacggtaatttggcgctggatctgatactgaaaaac
cgttccggtcagcttatcgcattgcgcaacggctgttatgccaatgtccctatcgatatc
gtatccagccgcaaaaaaattgtgacggtcgacaaatattacaacgcggaacgcctcaga
ccaaaatacgaaaccttccgcgaccagcccatgtttatcatgaccagcgagatgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system