KEGG   Pelobacter carbinolicus: Pcar_1548Help
Entry
Pcar_1548         CDS       T00285                                 

Gene name
holC
Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
pca  Pelobacter carbinolicus
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Pcar_1548 (holC)
   00240 Pyrimidine metabolism
    Pcar_1548 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Pcar_1548 (holC)
   03430 Mismatch repair
    Pcar_1548 (holC)
   03440 Homologous recombination
    Pcar_1548 (holC)
Enzymes [BR:pca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Pcar_1548 (holC)
DNA replication proteins [BR:pca03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Pcar_1548 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1813989..1814405
Genome map
AA seq 138 aa AA seqDB search
MTRVEFVKIKRPEKAKHLCELAEHFFTQGQRVLVMVCDDNQGVTLDRFMWTWKKGAFIPH
VYDNGAVDCLDEPVIIEVEERNPNNAGVLIMGKPCSLDFIRQFDLVIDFAELYEPQLKVA
ARKRYAHFRETGFEVAMR
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgggttgagttcgttaaaattaaacgccccgaaaaagcaaaacacctgtgtgaa
ttggccgagcattttttcactcaggggcaacgggtgttggtcatggtttgcgacgataat
cagggggtgaccctcgaccggttcatgtggacctggaagaagggagcctttattccgcat
gtttacgataatggggctgtggattgtcttgacgaaccggtcattattgaggtagaagaa
cgcaatccgaacaatgccggggtgctcattatgggcaagccctgttccttggattttatc
cgccagttcgatctggttattgattttgcggagctttacgagccgcagcttaaggttgcc
gcgaggaagcggtatgcgcattttcgggagaccggttttgaggttgccatgcgttaa

DBGET integrated database retrieval system