KEGG   Pelobacter carbinolicus: Pcar_1615Help
Entry
Pcar_1615         CDS       T00285                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pca  Pelobacter carbinolicus
Pathway
pca00240  Pyrimidine metabolism
pca00250  Alanine, aspartate and glutamate metabolism
pca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Pcar_1615 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Pcar_1615 (pyrB)
Enzymes [BR:pca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Pcar_1615 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace FrhB_FdhB_C
Motif
Other DBs
NCBI-ProteinID: ABA88859
JGI: Pcar1615
UniProt: Q3A448
Position
complement(1888665..1889606)
Genome map
AA seq 313 aa AA seqDB search
MAFNHKHILGIEQMSAEDITLILDTAESFKDVSLRSIKKVPTLRGKTVINVFFEASTRTR
TSFEIAGKRLSADTVNISASTSAVVKGETLEDTAKNLEAMKPDIIVMRHSCSGAPHYLAE
RCDFSVINAGDGAHEHPSQALLDLLTIRQKKGHIEGLTVAIIGDITHSRVARSNVYALNK
LGAEVRLCGPGTMLPPGIERLGAQVFDRIDDAVSGADVVMMLRIQQERQGKTMLPSLREY
SMFYGLTPDRMKLAKPDAIVMHPGPMNRGVEISSAVADGPQNVILDQVENGVAVRMALLY
LVSGGEKLEDSAQ
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcaatcacaagcatattcttggtatcgagcagatgtcggccgaggacataacc
ctcattctggatactgccgagagtttcaaggacgtaagcctgcggtctataaaaaaagta
cccactttgcgaggaaagacggttatcaacgtctttttcgaagcgagtacccgcactcgg
acctcctttgaaattgcagggaaaaggctctctgccgatacggttaacatcagcgcatcg
acctccgccgtggtgaagggggaaacgctggaggatacggccaagaatcttgaggccatg
aagcccgatatcattgtcatgcgtcactcctgctccggcgctcctcactatttagccgag
cgttgtgatttttcggtcatcaatgccggtgatggcgctcacgaacatcccagccaggca
ctgctggaccttctcaccatacggcagaagaaggggcatatcgagggattgacagtggct
attatcggcgacattacccatagtcgcgttgcccgatccaatgtttacgctctaaacaaa
ctgggtgccgaggtaagactgtgtggtcccggtaccatgttgccgcccggtattgagcgt
ctcggggcccaggtgttcgatcgcatcgacgatgccgtcagcggcgccgatgtcgtcatg
atgctgcgcattcagcaggaacgacaaggcaaaaccatgctgccttccctgcgggaatat
tccatgttttacgggctcaccccggatagaatgaagcttgcaaagcccgatgccattgtc
atgcaccccggccccatgaaccgcggtgtcgagatctcctcggcggtagcggatggacct
cagaatgttattctggatcaggtggaaaacggcgtggccgtgcgcatggcactgctttat
ctggtttctggcggtgaaaaactcgaagattcggcccagtaa

DBGET integrated database retrieval system