KEGG   Pelobacter carbinolicus: Pcar_1779Help
Entry
Pcar_1779         CDS       T00285                                 

Gene name
manB-2
Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
pca  Pelobacter carbinolicus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcar_1779 (manB-2)
   00030 Pentose phosphate pathway
    Pcar_1779 (manB-2)
   00051 Fructose and mannose metabolism
    Pcar_1779 (manB-2)
   00052 Galactose metabolism
    Pcar_1779 (manB-2)
   00500 Starch and sucrose metabolism
    Pcar_1779 (manB-2)
   00520 Amino sugar and nucleotide sugar metabolism
    Pcar_1779 (manB-2)
  Nucleotide metabolism
   00230 Purine metabolism
    Pcar_1779 (manB-2)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Pcar_1779 (manB-2)
Enzymes [BR:pca01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Pcar_1779 (manB-2)
    5.4.2.8  phosphomannomutase
     Pcar_1779 (manB-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2082376..2083728)
Genome map
AA seq 450 aa AA seqDB search
MTNLTCFKAYDIRGRLPDELNEEIAYRIGRSYAEYLKPGRVVVGRDVRLSSAALCDALSN
GLLDGGTDVFDIGLCGTEEIYFATFAEEMDGGIMVTASHNPMDYNGMKLVRQGSRPISGD
SGLDAIRELAQDNQFAPPVQRGTRTVLETRPRYIEHLLGYIDRQSLRPLKIVVNAGNGCA
GPVLDQLEQHLPFEFIKVHHDPDGAFPNGIPNPLLPENRSATAEAVVAHGADLGIAWDGD
FDRCFLFDEKGGFIEGYYVVGLLAAAFLQHHPGARIIHDPRLTWNTMDLVSELGGTAVMS
KTGHAFIKERMRQEDAVYGGEMSAHHYFRDFAYCDSGMIPWLLVTELMSRSGQPLSSLVG
ERIKCYPASGEINRRLSDPAATLSNIENHYRVGAKATDFTDGLSMEFDQWRFNLRCSNTE
PVVRLNVETRGDQGLMEQKTQEILGMMDAR
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatttaacttgctttaaagcctacgacatccgcggtcgtctgccggatgaactc
aacgaggaaatcgcttaccgtatcgggcggtcttatgccgagtatctgaagccgggccgg
gtggtggtgggtcgggatgtgcggctcagcagtgcggctttgtgtgatgcgctgagcaac
gggcttcttgatggtgggacggatgttttcgatatcggtttgtgcggtacggaagagatc
tatttcgccacctttgccgaggagatggatggcggcattatggtgacggccagtcacaat
cccatggattacaacggcatgaaactggtgcggcagggatcgcggcctatcagtggcgac
agtggtctggatgccattcgggagttggctcaggacaaccagtttgctccgccggtacaa
cgcggtacccgcactgttctggagacccggccgcgttatatcgaacatctgctgggctat
atcgaccggcaatcattgcggcctctgaagatcgtggtcaatgccggcaacggttgtgcc
ggtccggtactggatcagctggagcagcatctgccctttgagttcatcaaggtccatcat
gatccggacggtgcctttcccaacggcattcctaatcccctgttgccggaaaacaggtcg
gctacggccgaagcggtggtggcccacggtgcggatctggggattgcctgggatggtgat
tttgatcgttgttttctgttcgacgagaagggtggcttcatcgaggggtattatgtggtg
ggattgctggcggcggcgtttctgcagcaccaccccggagcccgcattatccacgacccc
cgtctgacctggaataccatggatctggtgtcggaactgggcggcacggcggtcatgagc
aagaccggccatgctttcatcaaggaacgcatgcggcaggaagatgcggtgtacggcgga
gagatgagcgctcaccattacttccgggattttgcctactgcgacagcggcatgattccc
tggctgctggtcaccgaactcatgagccgcagtggccagcctctttccagcctggtgggt
gagcggatcaaatgttatcccgccagcggcgagatcaatcgtcgcctgagcgatcccgct
gcaactctgtccaacatcgagaatcattatcgtgtcggtgcgaaagcaaccgattttacg
gatggattgagtatggagttcgatcagtggcggtttaacctgcgctgctccaataccgag
ccggtggtgcggttgaatgtcgaaacccggggtgatcaggggttgatggagcagaagacg
caggaaatcctaggcatgatggatgcgcgttag

DBGET integrated database retrieval system