KEGG   Pelobacter carbinolicus: Pcar_1915Help
Entry
Pcar_1915         CDS       T00285                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose-5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pca  Pelobacter carbinolicus
Pathway
pca00900  Terpenoid backbone biosynthesis
pca01100  Metabolic pathways
pca01110  Biosynthesis of secondary metabolites
pca01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pca00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Pcar_1915 (dxr)
Enzymes [BR:pca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Pcar_1915 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C BRD4_CDT
Motif
Other DBs
NCBI-ProteinID: ABA89156
JGI: Pcar1915
UniProt: Q3A3A1
Position
complement(2231374..2232558)
Genome map
AA seq 394 aa AA seqDB search
MASVKKLGILGSTGSIGVSTLDIVAAFPEQFEVVTLTAGNNLARLEEQIRRFRPKMVAVI
SADGAQQLKERLGADAPQILSGVEGLVACACHEDIDMVVSAIVGAAGLVPTMSAIETGKD
IALANKETLVTAGSLVTEAVARHGVRLFPVDSEHSAIFQSLEGHRMDDVRRLILTASGGP
FRNRMLADMASVTPADALAHPNWSMGRKISIDSATMMNKGLEVIEARWLFDVPAERIAVH
IHPQSIVHSLVEYVDGAVIAQLGIPDMKTPIAYALSHPTRLPLDLPPLDLCSMRNLTFDE
PDLERFPCLALAYEALAMGGTAPAVLNAANEIAVDAFLNEEIAFLDIARVIRAALQGLEV
KPLEHIDQVLRADLWGRKEARRFIDARGEGATVC
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgttaaaaaactcggcatcctcggatctaccggttccataggtgtaagtact
ctggatattgttgcggcttttcccgaacagttcgaggtcgttacccttacagccggcaac
aatctcgctcgtctggaggagcaaatccgccgcttccgtcccaaaatggtggcggtaata
tccgcggacggtgcgcagcagctgaaagagcgcctcggcgccgatgctccgcagatcctt
tccggggtcgaagggctggtggcgtgcgcctgtcatgaagatatagacatggttgtctcc
gccattgtcggcgcggccggcctggttccaaccatgtccgccatcgagacaggcaaggat
attgccctggccaacaaggaaacgttggtcacggccggttccctggttacggaagcggtc
gctcgccacggtgtgcggctgttccccgtggacagtgaacactccgctatcttccaatcg
ctggaaggccatcgtatggatgatgttcggcgacttatcctgacagcctcgggggggcct
tttcgcaaccggatgctggcggatatggccagtgtcactccggcagatgccctggctcat
ccgaactggagcatgggacgtaaaatctccatcgattccgccaccatgatgaacaagggg
ctcgaggttatcgaggcacgctggttgttcgatgtgccggcagagcgcattgccgtgcat
atccatccgcagagtattgtgcattccttggttgagtatgtcgatggtgcggtaattgcc
cagttaggtattcccgatatgaaaacccccattgcctatgccctgtctcaccccactcgt
ctgcctctggatctgccgccgctcgatctttgcagtatgcgcaatctcactttcgacgaa
ccggatctggagagatttccatgtctggccctggcctatgaagctctggcgatggggggc
accgctccggccgtacttaatgccgccaacgaaatcgctgtcgatgcttttctcaatgaa
gaaattgccttcctcgatatcgcccgggtgatacgcgccgcattgcagggcctggaggtc
aagccgctggaacatatcgaccaggttctgcgcgccgatctttggggtcgcaaggaagcc
cgccgctttatcgatgccaggggcgaaggagcgacggtatgctga

DBGET integrated database retrieval system